From owner-acedb@net.bio.net Tue Jun 03 23:00:00 1997 Path: biosci!bcm.tmc.edu!news.msfc.nasa.gov!news.maxwell.syr.edu!newsfeed.internetmci.com!news.chatlink.com!not-for-mail From: "Jeremiah Tilley" Newsgroups: alt.binaries.w-software,alt.comp.software.financial,amiga.software,at.tuwien.software,att.software-dev,att.software-dev.metatool,bfm.programmers.software.bondcalc,bionet.software,bionet.software.acedb,bionet.software.gcg,bionet.software.pc,bion Subject: Digital Mail Date: 3 Jun 1997 21:40:33 GMT Organization: - Lines: 5 Message-ID: <01bc709f$fc90f2c0$de698bcd@default> NNTP-Posting-Host: cl3-p4.chatlink.com X-Newsreader: Microsoft Internet News 4.70.1161 Xref: biosci bionet.software:18731 bionet.software.acedb:1253 bionet.software.gcg:2538 Try out this new software that allows you to communicate digitally with friends and family who don't have e-mail, but yet have a computer. Visit: http://www.chatlink.com/~pioneer/ From owner-acedb@net.bio.net Wed Jun 04 23:00:00 1997 Path: biosci!bloom-beacon.mit.edu!spool.mu.edu!uwm.edu!chi-news.cic.net!news.maxwell.syr.edu!news-was.dfn.de!news-kar1.dfn.de!news.embl-heidelberg.de!usenet From: Ramu Chenna Newsgroups: bionet.software.acedb Subject: INSTALL script does not work... Date: 5 Jun 1997 10:30:11 GMT Organization: EMBL Heidelberg Lines: 34 Distribution: world Message-ID: <5n64fj$1hn@lion.embl-heidelberg.de> NNTP-Posting-Host: shag.embl-heidelberg.de Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 1.12IS (X11; I; IRIX 5.3 IP22) X-URL: news:bionet.software.acedb?ALL Hello I got all the files according the to the instructions! (binary files, and update.WS* files) I kept all the files in the home directory from where I install the acedb. I sourced INSTALL script, it said installation is complete(!) Then I ran acedb and clicked on 'Add update File' I got a new window I clicked on All updates and it said 'Could not find file /disk2/chenna/acedb/rawdata/update.4.1 ' Now I have the files update.WS* in the home directory. How can i update with/without INSTALL script ? Regards Ramu =============================================================== Chenna Ramu | EMBL E-mail: chenna@embl-heidelberg.de | Postfach 10.2209 Tel: (49) 6221 356229 (Res) | 69012 Heidelberg (49) 6221 387398 (Off) | Germany Fax: (49) 6221 387517 URL: http://www.embl-heidelberg.de/~chenna/ =============================================================== From owner-acedb@net.bio.net Sun Jun 08 23:00:00 1997 Path: biosci!news.Stanford.EDU!su-news-hub1.bbnplanet.com!cpk-news-hub1.bbnplanet.com!news.bbnplanet.com!news-peer.sprintlink.net!news.sprintlink.net!Sprint!news-peer.gsl.net!uwm.edu!newsspool.doit.wisc.edu!news.doit.wisc.edu!news From: Jeff Hardin Newsgroups: bionet.software.acedb Subject: Pictures and movies in Macace Date: Sat, 07 Jun 1997 14:30:59 +0000 Organization: University of Wisconsin - Madison Lines: 17 Message-ID: <339970A2.4CD3@facstaff.wisc.edu> NNTP-Posting-Host: f182-205.net.wisc.edu Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.01 (Macintosh; I; PPC) Hi folks: I can't get display of pictures in Macace (C. elegans database). I discovered that I could fix the Unix version bt altering the display_script to point to ImageTool (my image viewer), but I can't do this for the Mac version. It use to work, on an earlier version. Is this now broken?? Thanks! Also, at one point you could display movies in Macace. Is this also broken? If not, do I need to make a new class called "Movies". One thing that would greatly help me out is a pointer to some real, live documentation on how to use this software, rather than my hacking. Many thanks! Jeff From owner-acedb@net.bio.net Sun Jun 08 23:00:00 1997 Path: biosci!news.Stanford.EDU!su-news-hub1.bbnplanet.com!cpk-news-hub1.bbnplanet.com!news.bbnplanet.com!feed1.news.erols.com!newsfeed.internetmci.com!news-was.dfn.de!news-fra1.dfn.de!zeus.rbi.informatik.uni-frankfurt.de!grapool30.rz.uni-frankfurt.de!News.Uni-Marburg.DE!not-for-mail From: Michael Otto Newsgroups: bionet.software.acedb Subject: WEBACE with Perl 5.003, ACeDB 4.3 and CGI 2.36 Date: 9 Jun 1997 09:26:01 GMT Organization: HRZ Uni Marburg Lines: 16 Message-ID: <339BCC3D.5456@Mailer.Uni-Marburg.DE> Reply-To: otto@Mailer.Uni-Marburg.DE NNTP-Posting-Host: pc2010.humangenetik.humanmedizin.uni-marburg.de Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0 (WinNT; I) to all who are interested in: some time ago I wrote about difficulties running the >webace< WWW<->ACeDB Interface on our SUN Sparc Station. Now we fixed the problem with assistance from Mike Holman. The following Versions work together: ACeDB v4.3 Perl v5.003 CGI v2.36 SunOS v4.1.4 NCSA v1.5.2 (as WEB-Server) hope this may help someone... - Michael Otto - From owner-acedb@net.bio.net Tue Jun 10 23:00:00 1997 Path: biosci!shox.com!sales From: sales@shox.com (SHOX) Newsgroups: bionet.software.acedb Subject: SHOX Date: 10 Jun 1997 21:56:55 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 28 Sender: daemon@net.bio.net Distribution: world Message-ID: <3.0.1.32.19970609093001.006aa640@professionals.com> NNTP-Posting-Host: net.bio.net Fixedsys<<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<> If you believe that you've received this message in error, simply reply with the message REMOVE and you'll be permanently eliminated from further mailings. <<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<><<> sales@shox.com Come visit http://www.shox.com, the home page of RD Enterprises, the nations largest wholesale and retail distributor of shock absorbers, springs, struts, sway bars, strut tower braces and suspension packages for street high performance, autocross, race, and quality luxury motorcars...including suspension set-ups for pick-up trucks, sport utility vehicles (SUV's), motorhomes, kit cars, weekend slalom, and full coil over race cars. If you are interested in a mutual link, contact linx@shox.com for a banner swap and/or mutual link. sales@shox.com http://www.shox.com From owner-acedb@net.bio.net Tue Jun 10 23:00:00 1997 Path: biosci!TITUS.U-STRASBG.FR!simon From: simon@TITUS.U-STRASBG.FR (Simon Whitfield) Newsgroups: bionet.software.acedb Subject: Error when inputting peptide sequences Date: 11 Jun 1997 06:38:38 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 34 Sender: daemon@net.bio.net Distribution: world Message-ID: <339EAB06.4822@igbmc.u-strasbg.fr> NNTP-Posting-Host: net.bio.net Hello, I'm trying to read protein sequences into AceDB 4.3 via ace files. I _think_ I have the syntax right for the peptide data, but I get an error message. For example, the entry Protein SW:Q01705 Title "NTC1_MOUSE..." DNA_homol MMNOTCHA "BLASTX" 14408 1 2531 79 7671 Database SWISSPROT Q01705 Peptide SW:Q01705 MPRLLTPLLCLTLLPARAARGLRCSQPSGTCLNGGRCEVASGTEACVASGSFVGQRCQDP NPCLSTRCKNAGTCYVVDHGGIVDYACSCPLGFSGPLCLTPLDKPCLANPCRNGGTCDLL TLTEYKCRCSPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVN gives the error message "Type of SW:Q01705 does not check in B object "SW:Q01705" " Can anyone explain to me what is going on? Thanks, Simon Whitfield simon@igbmc.u-strasbg.fr -- IGBMC, BP 163, 67404 Illkirch Cedex, C.U. de Strasbourg, France. Phone (+33) 03 88 65 34 33 Fax (+33) 03 88 65 32 46 From owner-acedb@net.bio.net Wed Jun 11 23:00:00 1997 Path: biosci!ihnp4.ucsd.edu!gondor!sol.ctr.columbia.edu!news.indiana.edu!vixen.cso.uiuc.edu!news-peer.sprintlink.net!news.sprintlink.net!Sprint!cpk-news-hub1.bbnplanet.com!news.bbnplanet.com!news.apfel.de!univ-lyon1.fr!pasteur.fr!jussieu.fr!infobiogen.fr!lovelace.infobiogen.fr!pollet From: Nicolas Pollet Newsgroups: bionet.software.acedb Subject: aceserver executable Date: Thu, 12 Jun 1997 17:54:14 +0200 Organization: "GIS INFOBIOGEN, 7 rue Guy Moquet BP8, 94801 VILLEJUIF, France" Lines: 15 Message-ID: NNTP-Posting-Host: lovelace.infobiogen.fr Mime-Version: 1.0 Content-Type: TEXT/PLAIN; charset=US-ASCII Dear all Ace gurus, I am beginning a quest, the aim of which being to run a wwwace interface to an acedb database of gene expression patterns. My first milestone is to find the executable for the aceserver. I would be very pleased if somebody can point me to a place where I can find it. Thank you very much in advance, Nicolas Dr Nicolas Pollet e-mail: n.pollet@dkfz-heidelberg.de Division of Molecular Embryology DKFZ Tel:(+49)-6221-42-4694 INF 280 Fax:(+49)-6221-42-4692 D-69120 Heidelberg http://www.dkfz-heidelberg.de/abt0135/hpeng.htm From owner-acedb@net.bio.net Fri Jun 13 23:00:00 1997 Path: biosci!agate!spool.mu.edu!uwm.edu!news.he.net!news2.fibr.net!news1.fibr.net!news.fibr.net!news From: Newsgroups: bionet.software.acedb Subject: http://www.planetfun.com/videosex.htm Date: 14 Jun 1997 05:51:03 GMT Lines: 3 Message-ID: <5ntbg7$eb3@nimitz.fibr.net> NNTP-Posting-Host: port1-6.lconn.com http://www.planetfun.com/videosex.htm Adults Only From owner-acedb@net.bio.net Fri Jun 13 23:00:00 1997 Path: biosci!agate!spool.mu.edu!uwm.edu!news-peer.gsl.net!news-hk.gsl.net!news.gsl.net!ruby.hknet.com!usenet From: "Vampire" Newsgroups: bionet.software.acedb Subject: Bomb Email Date: 14 Jun 1997 10:02:15 GMT Organization: Microsoft Windows 95 Lines: 5 Message-ID: <01bc78aa$058afee0$4cf443ca@hknet> NNTP-Posting-Host: mp329.hknet.com X-Newsreader: Microsoft Internet News 4.70.1157 Hi Everyone, §Ú·Qª¾¥h¨ºùدàdownload¤@¨Ç¥i¥H bomb¤Hemailªºsoftware,¦]¬°§Úµ¹¤Hbomb¤F,©Ò¥H§Ú·Q³ø¤³ ¦pªGª¾¹Dªº,½Ð¦U¦ì¤j¨Ð¯àÁ¿µ¹§Úª¾ Thanks From owner-acedb@net.bio.net Mon Jun 16 23:00:00 1997 Path: biosci!PUBLIC.EAST.CN.NET!yijian From: yijian@PUBLIC.EAST.CN.NET (Dongyi Du) Newsgroups: bionet.software.acedb Subject: for help Date: 16 Jun 1997 17:36:13 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 12 Sender: daemon@net.bio.net Distribution: world Message-ID: <33A65D8D.4CB6@public.east.cn.net> Reply-To: yijian@public.east.cn.net NNTP-Posting-Host: net.bio.net Dear Sir; I am a Chinese science researcher.Our lab. have bouhgt the GENE/PROTEIN SEQUENCE DATABASE OF 1994 PUBLISED,which include five discs,but we lose the user manual,I do not know how to renew the old 5.00 DNASIS,could you do me favor? Thank you very much.I am looking forward to hearing from your. Sincerely your, Dongyi Du From owner-acedb@net.bio.net Sat Jun 21 23:00:00 1997 Path: biosci!agate!hammer.uoregon.edu!hunter.premier.net!feed1.news.erols.com!news-peer.sprintlink.net!news.sprintlink.net!Sprint!vixen.cso.uiuc.edu!news.stealth.net!news.ibm.net.il!ibm.net!not-for-mail From: yuvalp@ibm.net Newsgroups: alt.comp.software.easter-eggs,bionet.software,bionet.software.acedb,bionet.software.gcg Subject: DO U WANT TO FIND WHAT U WANT QUICKLY & EASILY ? Date: Sun, 22 Jun 1997 14:56:41 +0300 Organization: Unspecified Organisation Lines: 22 Message-ID: <33AD12F9.2B67D503@ibm.net> NNTP-Posting-Host: slip139-92-89-148.tel.il.ibm.net Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 4.01 [en] (Win95; I) X-Priority: 3 (Normal) Xref: biosci bionet.software:18905 bionet.software.acedb:1279 bionet.software.gcg:2581 Hey , You should check out this great new program which called "Personal Crawler" and here is its Main Features: * Searches within a specific site - or a pre-defined list of sites. * Lightning-fast - runs a dozen searches simultaneously. * View a site by its components - images, movies, links and more. * Creates a Java-based site navigation map with a single click. * Easily installed and operated. go here for download : http://www.vci.co.il/download/cra.zip or here for more details : http://www.vci.co.il/crawler.htm or search for it in http://www.download.com or in http://www.hotfiles.com Bye Bye Yuval .P. yuvalp@ibm.net From owner-acedb@net.bio.net Mon Jun 30 23:00:00 1997 Path: biosci!agate!hammer.uoregon.edu!newsfeed.internetmci.com!newsfeed.nacamar.de!supernews.com!Supernews69!not-for-mail From: a;lfk@lkja.com Newsgroups: bionet.software.acedb Subject: BEST PRICE 1-800 SERVICE!!!! Date: 1 Jul 1997 21:01:51 GMT Organization: All USENET -- http://www.Supernews.com Lines: 2 Message-ID: <5pbr7v$4ms$3@usenet85.supernews.com> NNTP-Posting-Host: 207.211.62.221 From owner-acedb@net.bio.net Mon Jun 30 23:00:00 1997 Path: biosci!bcm.tmc.edu!news.msfc.nasa.gov!news.maxwell.syr.edu!cpk-news-hub1.bbnplanet.com!news.bbnplanet.com!europa.clark.net!dispatch.news.demon.net!demon!easynet-uk!news.ox.ac.uk!news From: John Peden Newsgroups: bionet.software.acedb Subject: Efetch in acedb Date: Tue, 01 Jul 1997 14:55:55 +0100 Organization: Oxford Molecular Biology Data Centre Message-ID: <33B90C6B.93E1FB92@molbiol.ox.ac.uk> NNTP-Posting-Host: udcpc3.jr2.ox.ac.uk Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 4.01 [en] (Win95; I) X-Priority: 3 (Normal) Lines: 16 Hi I am running versin 4.3 of acedb. When right clicking on a protein homology match and select efetch, the sequence is retrieved from the sanger www efetch server. I have set acedb's blixem to retrieve sequences from our own local databases by writing an efetch wrapper. Is it possible to persuade acedb when right clicking to similarly retrieve sequences locally or does it always default to the www server. john ________________________________________________________________________ John Peden | johnP@molbiol.ox.ac.uk Molecular Biology Data Centre | Fax. 01865 2-75501 University of Oxford | If its not broke -- then don't fix it ------------------------------------------------------------------------- From owner-acedb@net.bio.net Mon Jun 30 23:00:00 1997 Path: biosci!internet!biosci!not-for-mail From: biohelp (BIOSCI Administrator) Newsgroups: bionet.software.acedb Subject: BIOSCI/bionet miniFAQ & Fundraiser Date: 1 Jul 1997 02:00:06 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 233 Sender: daemon@net.bio.net Distribution: world Message-ID: <199707010900.CAA18474@net.bio.net> NNTP-Posting-Host: net.bio.net (LAST REVISION: 30-JUL-95) This BIOSCI "miniFAQ" is designed to answer the questions that come up the *most frequently*. The main BIOSCI FAQ (Frequently Asked Questions) is accessible on the World Wide Web at URL http://www.bio.net/. If you can not find an answer to your question in this or other documentation, the BIOSCI technical support staff answers e-mail queries sent to biosci-help@net.bio.net We can only answer questions about the use of the newsgroups and mailing lists. We unfortunately do not have the staff to do Internet information searches or answer scientific questions. Please post those to the appropriate BIOSCI/bionet newsgroups. Contents: -------- 0) BIOSCI NEEDS YOUR SUPPORT!! 1) Using the WWW to access the BIOSCI/bionet newsgroups. 2) What to do about "spams," i.e., junk mail, ads, etc. 3) Examples of subscribing and unsubscribing to the mailing lists. 4) The BIOSCI user address and research interest directory. 0) BIOSCI NEEDS YOUR SUPPORT!! ------------------------------ BIOSCI's government funding has been expended, and we are now operating solely from advertising revenue that we have raised from our Web site at http://www.bio.net/. We need just a few minutes of your time to help us serve you. You can do two important things which will take very little time for you individually and will immensely help us continue to help you. First, please use our WWW system at http://www.bio.net/ to access the archives. You can post or reply to messages via your Web browser as described in item #1 below. Your usage helps attract sponsors. If you contact any of our sponsors, please be sure to thank them for supporting BIOSCI. It is critical for them to get this feedback if they are to continue their sponsorship for the long term. Second, if you work for a company or organization that provides products or services of interest to the biology community, please pass this message on to your marketing or marketing communications department or other appropriate group. Please ask them to help support BIOSCI by sponsoring our Web site and explain the uses and benefits of the system to the biology community. If they are interested, they can then contact us for further information at our tech support address, biosci-help@net.bio.net. 1) Using the WWW to access the BIOSCI/bionet newsgroups. -------------------------------------------------------- As of 10 December 1995, all BIOSCI/bionet full newsgroups are accessible through the World Wide Web (WWW) at URL http://www.bio.net. One can read and reply publicly or privately to both recent postings and archived messages through one's Web browser if it is configured properly to send e-mail. Each newsgroup is equipped with its own WAIS index. The main BIOSCI home page also has access to the BIO-JOURNALS Table of Contents database WAIS index and the BIOSCI user address database described in another item further below. 2) What to do about "spams," i.e., junk mail, ads, etc. ------------------------------------------------------- BIOSCI is a set of parallel USENET newsgroups (the "bionet" groups), mailing lists, and a hypermail archive at URL http://www.bio.net/. The same postings are distributed on all media (except for a small number of mailing-list-only groups at net.bio.net). Unfortunately it is becoming a despicable practice on the Internet (by a few people out to make a fast buck) to do automated mass postings to thousands of newsgroups and mailing lists. These attempts to grab free advertising are refered to as "spams" in the usual, somewhat boneheaded, net terminology. USENET is more susceptible to this practice, and many spams originate on the USENET groups and then are passed on to the mailing lists. However, spammers also get lists of mailing addresses and hit these too, so neither medium is immune. What should you do personally if you get junk mail? --------------------------------------------------- Just delete it and move on without reading it further. Filing a protest is becoming increasingly useless because spammers are often disguising the addresses where the messages are sent from. Unless you really understand Internet mail systems, your attempt at protest by sending replies to the message will often end up being sent to the address of an innocent person that the spammer is victimizing. What can BIOSCI/bionet do to protect its newsgroups? ---------------------------------------------------- The only solution currently available is to moderate the newsgroup. If this newsgroup is already moderated, then you are in good shape. Moderation protects the USENET distribution from about 95% of the spams that are being sent to date and protects the mailing lists completely. Moderation means, however, that someone has to take the time to review each message before it goes out. We have set up software here that simply allows the moderator to forward to an address at net.bio.net messages that (s)he wishes to have distributed. This takes no more time than that needed to read the message and pass it on, say about 1 min. per message. Most newsgroups currently have a discussion leader who is responsible for their newsgroup. The discussions leaders and their e-mail addresses are listed in the BIOSCI Information Sheet which is available on the Web at http://www.bio.net/. If a newsgroup is being hit with too many junk postings, please contact the discussion leader for that group and see if there is interest in moderating the group. Please do not assume that by simply posting a complaint to the newsgroup itself, anyone on the BIOSCI staff will act on your complaint. With close to 100 newsgroups to run, the BIOSCI staff has to rely on the discussion leaders of each newsgroup to report problems directly to us at biosci-help@net.bio.net. We will moderate any of our newsgroups if the discussion leader tells us that the readership of the group wishes to do so and if a moderator is willing to do the work. For most BIOSCI/bionet groups, this entails only a few minutes of work each day. Moderating a newsgroup will resolve probably 95% of the junk postings on the USENET distribution. Unfortunately there are easy ways for determined spammers to override the moderation mechanism on USENET, but we can protect our e-mail subscribers from unwanted postings if the newsgroup is moderated. You can also access our newsgroups over the WWW at URL http://www.bio.net. While this Web interface will not stop spammers from trying to post to the groups, this will give you yet another way, besides using USENET news, to keep the junk out of your personal mail files. For those of you with local USENET news systems, the Web interface will also give you faster access to new newsgroups and recent postings. 3) Examples of subscribing and unsubscribing to the mailing lists. ------------------------------------------------------------------ PLEASE NOTE: The BIOSCI management does NOT act on subscription/unsubscription requests that are posted improperly to the newsgroups and mailing lists. People who do this only bother everyone on the lists to no avail. Please be sure to follow the proper procedures below. Gory details are in the BIOSCI Information sheets on the Web at http://www.bio.net. Below we give an example utilizing the METHODS-AND-REAGENTS list at both of our two BIOSCI sites: Users in the Americas and Pacific Rim countries who use the BIOSCI ------------------------------------------------------------------ node at computer net.bio.net: ---------------------------- A) Determine the "listname" which is the <=8 character mail address ^^^^^^^^^^^^^ for the group. These can be found in the BIOSCI Info. Sheet. For the METHODS-AND-REAGENTS group the mailing address is methods@net.bio.net. The listname is the portion of the address to the left of the @ sign, i.e., "methods". The listname is used with the "subscribe" and "unsubscribe" commands illustrated below. B) Mail all commands in the body of a mail message addressed to biosci-server@net.bio.net. Do NOT send commands to the newsgroup posting addresses! Leave the Subject: line blank, any text on it will be ignored. C) In the body of your message put one or more of the following commands with an "end" command on the last line, e.g., subscribe methods unsubscribe methods end Do NOT put your e-mail address or other text on these lines. The server only allows you to cancel your subscription if the address on your mail header matches the address on our mailing list. Please ask for help at biosci-help@net.bio.net if your address has changed, e.g., if you know you are on the list but the server tells you that you are not a member. Users in Europe, Africa, and Central Asia who use the BIOSCI node at -------------------------------------------------------------------- computer daresbury.ac.uk (also known as dl.ac.uk): ------------------------------------------------- To subscribe and unsubscribe to/from the BIOSCI lists, you need to specify the full USENET newsgroup name with "bionet-news." prepended. The USENET newsgroup names are listed in the BIOSCI Information sheet on the Web at http://www.bio.net/. For the METHODS-AND-REAGENTS list the USENET newsgroup name is bionet.molbio.methds-reagnts, thus the appropriate commands are sub bionet-news.bionet.molbio.methds-reagnts unsub bionet-news.bionet.molbio.methds-reagnts These commands are included in a message addressed to mxt@dl.ac.uk, NOT to the newsgroup mailing addresses. As usual, include the text in the body of the message as text on the Subject: line is ignored. To unsubscribe from all the lists at the UK node, use unsub bionet-news Please note that if the address in the list is different than the one in your mail message header, you will not be able to unsubscribe by this method. If you have problems, please mail biosci@daresbury.ac.uk. 4) The BIOSCI user address and research interest directory. ----------------------------------------------------------- Please take this opportunity to add your name, address, and research interest information to the BIOSCI User Address Database if you have not already done so. You can fill out the address form directly through our Web page at URL http://www.bio.net/adrform.html. The address database is reindexed nightly for WWW access (the URL is http://www.bio.net/). If you are not directly on the Internet but can reach it by e-mail, please use our waismail server to access the user directory. waismail use is described above. You can also request a user address form by e-mail from biosci-help@net.bio.net. Please check your database entry from time-to-time to see if your address information is still up-to-date. Because of our limited personnel resources, we ask that you resubmit a *complete* form to revise your entry; we only replace complete entries and do not have resources to edit old forms.