From owner-arabidopsis@net.bio.net Wed Dec 01 22:00:00 1993 Path: biosci!bcm!cs.utexas.edu!uunet!biosci!u-shizuoka-ken.ac.jp!hirokazu From: hirokazu@u-shizuoka-ken.ac.jp (Hirokazu KOBAYASHI) Newsgroups: bionet.genome.arabidopsis Subject: (none) Message-ID: <9311251304.AA06554@fns1.u-shizuoka-ken.ac.jp> Date: 25 Nov 93 13:04:41 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 10 Subject: Reply to a question of DAPI staining The DAPI staining of Arabidopsis roots has been reported in Planta (1993) 189: 443-452 by M. Fujie, H. Kuroiwa, S. Kawano, & T. Kuroiwa, as far as I know. Hiro Kobayashi UNIVERSITY OF SHIZUOKA NATIONAL INSTITUTE FOR BASIC BIOLOGY (Adjunct) e-mail: hirokazu@u-shizuoka-ken.ac.jp From owner-arabidopsis@net.bio.net Wed Dec 01 22:00:00 1993 Path: biosci!ATGENOME.BIO.UPENN.EDU!pdunn From: pdunn@ATGENOME.BIO.UPENN.EDU Newsgroups: bionet.genome.arabidopsis Subject: Call for yUP data Message-ID: <9312012347.AA13882@atgenome.bio.upenn.edu> Date: 1 Dec 93 23:47:49 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 34 Dear Arabidopsis Researchers, We are collecting all of the available genome data that people have generated using the yUP library so that it can be entered it into the object oriented database Genome Topographer. The data can be submitted anonymously, i.e. you do not have to indicate which gene(s) you are interested in cloning. The data will be displayed in terms of probe names, genetic distances, physical distances and YAC clones identified. We are interested in compiling the data into Genome Topographer so that everyone can have access to the data. There are cases where people with different interests are walking in the same area of the genome and are not aware of others efforts. Genome Topographer would allow us to maximize our information and resources. Any data that you have from other YAC libraries or other cloning vectors would also be appreciated. 1. Which probes have you used to identify YAC clones? 2. Which YACs did you identify? 3. Do you have data on the genetic order and distances of your probes? Which population(s) did you use to generate your data? 4. What do you know about the YACs (e.g. size, internal deletions, chimeras, repetitive DNA (e.g. chloroplast, rDNA, mtDNA))? 5. Have you generated endprobes and genetically and/or physically mapped them? Thank you for your attention and your responses. Pat Dunn pdunn@atgenome.bio.upenn.edu ----- End Included Message ----- From owner-arabidopsis@net.bio.net Wed Dec 01 22:00:00 1993 Path: biosci!bcm!cs.utexas.edu!howland.reston.ans.net!pipex!uknet!daresbury!not-for-mail From: N.J.Butt@sussex.ac.uk (Neil Butt) Newsgroups: bionet.genome.arabidopsis Subject: 2-hybrid system Message-ID: <2d50ut$cf@mserv1.dl.ac.uk> Date: 26 Nov 93 13:39:41 GMT Sender: daemon@mserv1.dl.ac.uk Distribution: bionet Lines: 16 Original-To: arab-gen@dl.ac.uk Dear Users, We would be very grateful if anyone could supply us with any information on Arabidopsis cDNA libraries for use in the two- hybrid system. I know some mention of this protocol was made in Ohio and we are keen to use it for our work. If someone possesses such a library we would be very grateful for an aliquot. Otherwise any information will be a help. Neil Butt Biological Sciences University of Sussex Brighton, BN1 9QG U.K From owner-arabidopsis@net.bio.net Wed Dec 01 22:00:00 1993 Path: biosci!bcm!cs.utexas.edu!uunet!biosci!SASK.USASK.CA!KINGJ From: KINGJ@SASK.USASK.CA Newsgroups: bionet.genome.arabidopsis Subject: Faculty Positions Message-ID: <01H5RJA7OGX28WWE1O@SKYCAT.USask.CA> Date: 26 Nov 93 14:31:57 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 21 The Department of Biology, University of Saskatchewan invites applications for TWO tenure-track positions at the Assistant Professor level in the area of plant morphology and plant molecular biology. Candidates should hold a Ph.D. degree; postdoctoral experience will be an asset. The successful candidate in plant morphology will be expected to teach a second-year course on the survey ofvascular plants in addition to other teaching duties; the plant molecular biologist should preferably have research experience in recombinant DNA technology. The positions will be available July 1, 1994. In accordance with Canadian immigration requirements, priority will be given to Canadian citizens and permanent residents. The University of Saskatchewan is committed to the principles of employment equity: women candidates, candidates of aboriginal descent, and candidates from other minority groups are especially encouraged to apply. Send curriculum vitae and the names, addresses and telephone or FAX numbers of at least THREE referees, and a brief description of research interestand teaching capabilities to: Dr. R.J.F. Smith, Department of Biology, University of Saskatchewan, Saskatoon, SK., S7N 0W0, Canada. Tel:(306)966-4400 FAX:(306)966-4461; E-mail; "SMITHR@SASK.USASK.CA". Position subject to budgetary approval. The closing date for applications is January 15, 1994. From owner-arabidopsis@net.bio.net Wed Dec 01 22:00:00 1993 Path: biosci!bcm!cs.utexas.edu!howland.reston.ans.net!pipex!uknet!daresbury!not-for-mail From: robaglia@tournesol.versailles.inra.fr (Christophe Robaglia) Newsgroups: bionet.genome.arabidopsis Subject: yeast transformation Message-ID: <2d5dgj$9a4@mserv1.dl.ac.uk> Date: 26 Nov 93 17:13:55 GMT Sender: daemon@mserv1.dl.ac.uk Distribution: bionet Lines: 11 Original-To: arab-gen@dl.ac.uk Dear networkers, I am trying to complement yeast mutant with arabidopsis cDNA libraries. The problem is that I can't get more than 1000 transformant per ug DNA using the LiAc protocol described by (Gietz et al, 1992, NAR, 20, p142),. changing the PEG 4000 to PEG 6OOO did already increase the yield nearly 10 times. As the expected number of transformant is 500000-1000000 I would be very grateful to anybody which can give some help to improve the method. I already know that my particular yeast strain is as "transformable" as standard strain and I suspect some toxicity problem in the compounds used. Thank you in advance. christophe Robaglia From owner-arabidopsis@net.bio.net Wed Dec 01 22:00:00 1993 Path: biosci!bcm!cs.utexas.edu!uunet!biosci!SASK.USASK.CA!KINGJ From: KINGJ@SASK.USASK.CA Newsgroups: bionet.genome.arabidopsis Subject: Faculty Positions Message-ID: <01H5RJX584BW8WWE1O@SKYCAT.USask.CA> Date: 26 Nov 93 14:46:49 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 24 The Department of Biology, University of Saskatchewan invites applications for TWO tenure-track positions at the Assistant Professor level in the areas of plant morphology and plant molecular biology. Candidates should hold a Ph.D. degree; postdoctoral experience will be an asset. The successful candidate in plant morphology will be expected to teach a second-year course on the survey of vascular plants in addition to other teaching duties; the plant molecular biologist should preferably have research experience in recombinant DNA technology. The positions will be available July 1, 1994. In accordance with Canadian immigration requirements, priority will be given to Canadian citizens and permanent residents. The University of Saskatchewan is committed to the principles of employment equity: women candidates, candidates of a aboriginal descent, and candidates from other minority groups are especially encouraged to apply. Send curriculum vitae and the names, addresses and telephone or FAX numbers of at least THREE referees, and a brief description of research interests and teaching capabilities to: Dr. R.J.F. Smith, Department of Biology, University of Saskatchewan, Saskatoon, SK., S7N 0W0, Canada. Tel: (306) 966-4400; FAX: (306) 966-4461; E-mail: "SMITHR@SASK.USASK.CA". Position subject to budgetary approval. The closing date for applications is January 15, 1994. From owner-arabidopsis@net.bio.net Thu Dec 02 22:00:00 1993 Path: biosci!kristoff From: kristoff@net.bio.net (David Kristofferson) Newsgroups: bionet.genome.arabidopsis Subject: IMPORTANT!!! - BIOSCI at net.bio.net off-line this ENTIRE WEEKEND!! Message-ID: Date: 3 Dec 93 00:28:46 GMT Organization: BIOSCI International Newsgroups for Biology Lines: 26 We are aware of continuing problems with duplicated messages and are taking the BIOSCI system off-line from 5 PM Friday, 6 DEC, until Monday AM. The message duplication is caused by a relatively infrequent but recurring file corruption problem that we have been experiencing with our news message tracking database. We will be doing a news system software upgrade over the weekend. All BIOSCI services including e-mail, news, WAIS, Gopher, FTP archive access, etc. will be inaccessible over the weekend, so here is your chance to take a short break from e-mail overload 8-). I am going to post this note to several of the more popular groups to ensure that as many readers as possible see it. My apologies if you subscribe to several of these groups by e-mail - you will get one copy for each group that you receive. Sincerely, Dave Kristofferson BIOSCI/bionet Manager biosci-help@net.bio.net From owner-arabidopsis@net.bio.net Thu Dec 02 22:00:00 1993 Path: biosci!lhc!darwin.sura.net!paladin.american.edu!europa.eng.gtefsd.com!uunet!news.sprintlink.net!demon!diacam.demon.co.uk!rpf From: rpf@diacam.demon.co.uk (Roger Freedman) Newsgroups: bionet.genome.arabidopsis Subject: Re: email address? Message-ID: <754827699snz@diacam.demon.co.uk> Date: 2 Dec 93 10:21:39 GMT References: <44872.DGalbrai@CCIT.ARizona.EDU> Sender: usenet@demon.co.uk Reply-To: rpf@diacam.demon.co.uk Distribution: bionet Organization: Diatech Lines: 21 X-Newsreader: Simple NEWS 2.0 (ka9q DIS 1.24) Back in June he was reputedly R A Jefferson CAMBIA CSIRO Division of Plant Industry GPO Box 1600 Cnr Clunies Ross St and Barry Drive CANBERRA ACT 2601 Australia office 010-61-6-246-5302 lab -5308 fax -5303 E-Mail cambia@pican.oz.au Roger Freedman From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!NATURE.BERKELEY.EDU!clincoln From: clincoln@NATURE.BERKELEY.EDU Newsgroups: bionet.genome.arabidopsis Subject: PCR on intact tissue Message-ID: <9312051759.AA07127@nature.berkeley.edu.cnr-net> Date: 5 Dec 93 17:55:36 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 102 Here are some of the responses I received to my question about PCR on intact Arabidopsis tissues. Thanks to all who sent me a message. Cindy Lincoln PGEC Albany, CA > Has anyone used the procedure for doing PCR on intact plant tissue > described in Klimyuk et al, The Plant Journal (1993)3:493-494 on > Arabidopsis tissue (such as seedlings)? Have other procedures been > developed for PCR on intact tissue? -------------------------------------------------------------------------------- I have been using the procedure described in Klimyuk et al on sprout tissue. Basically I sprout the plants on wet filter paper and clip them off the paper and into the NaOH as soon as they have green tops and are long enough to reasonably get a hold of. I've been putting about 4-10 sprouts in each tube, but it has worked with as few a s 2 and as many as 15. We've been using this technique to do SSLP screening.It has allowed us to go from seed to scoring the sprouts for RFLPs in about 5 days.I have been able to score the amplified product with about an 87% success rate. I suspect that the variability has to do with differences between the two primers I'm using and the higher concentration of contaminants from the filter paper, the seed coat, and the fungus and mold which grows on the old sprouts (I haven't been sterilizing the seed). Hope this info is of some use to you. -Airlie Sattler Cindy, Regarding the PCR of intact tissue. It is great! I routinely use it on cauline leaves of Arabidopsis thaliana. One sample was a small piece of stem which failed to break up with a micropipette tip so I added one microlitre of the solution and got a signal. Have also used a very dried up dead leaf and obtained a signal. No worries. Cameron Johnson Genetics and Developmental Biology Monash University Melbourne, Australia Hi. I have used the Plant J. procedure, and it usually works. I have yet to determine if my problems are primer-specific or PCR machine specific, or both. Ricardo Azpiroz Plant Sciences U. Arizona. We used the procedure of Berthomieu and Meyer (plant. mol Biol 17: 555-557 {1991}) successfully on leaf material from sterile plants. However, I would stress using sterile plant material, our first attempts on soil grown plants yielded a homolog to the gene we were interested in, but this did not cross hybridise on Arabidopsis Southern blots. Hope this is of some help Neil Butt Bilogical Sciences University of Sussex Brighton, BN1 9QG. UK Dear Cindy, I have tried the Klimyuk method using individual flowers, half an inflorescence, and a silique. I essentially followed the protocol as published, and I had very good success with individual flowers, and progressively less success with the more material that I used. I had NO success with siliques, even rather young ones. Good luck! Leslie Sieburth (Meyerowitz Lab) Klimyuk's protocol works beautifully on Arabidopsis seedlings and is simplest I know of. Dima Belostotsky dimtry@bscr.uga.edu I have used intact tissue for PCR without any problem. I simply cut off a tiny little bit of material and used it directly in a PCR reaction. All material, even dried siliques worked fine, except for intact seeds. I believe that the cutting opens enough clls so that PCR is started from the damged cells. When I used roots, I saw a strong correlation between amount of material and successful amplification. The less material the better. What I routinely did was punching little leaf discs out of leaves using yellow pipettip. This tiny piece was then eluted into the PCR solution. Sucking the PCR solution up and down with the pipet without even displacing the leafdisc produced excellent results. Rigorous negative controls were included and I never had any fals positives. This methods may be very useful for screening lots of individual seedlings, since you don't have to do anything to the seedlings except for punching a hole into the leaf. Roger Aeschbacher Dept. of Biology New York University From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!JUDY.ENG.UCI.EDU!liang From: liang@JUDY.ENG.UCI.EDU (liang) Newsgroups: bionet.genome.arabidopsis Subject: CHINESES_BIOTECH_NET_FOUNDED Message-ID: <9312061945.AA20428@judy.eng.uci.edu> Date: 6 Dec 93 19:45:26 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 12 CBNet (Chinese Biotechnology Network) is a non-profit organization composed of professionals in biological, chemical, medical sciences, engineering and related fields. The CBNet sponsors the Chinese Biotechnology Internet Forum (CBIF) newsletter. To subscribe CBIF, please send an email to Listserv@UCSD.Edu with the message body: Add CB-Net. From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!AGCS.CAS.PSU.EDU!Dane_Fisher From: Dane_Fisher@AGCS.CAS.PSU.EDU ("Dane Fisher") Newsgroups: bionet.genome.arabidopsis Subject: RNA tissue printing Message-ID: <9312071850.AA29822@net.bio.net> Date: 7 Dec 93 18:44:25 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 10 I am interested in doing tissue printing of seedlings for RNA expression analysis of transgenes in several transgenic lines. Does anyone have a good protocol for doing multiple samples? I plan to use labelled cDNA probes. Thanks Dane Fisher dane_fisher@agcs.psu.edu From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!GARNET.BERKELEY.EDU!mlaskow From: mlaskow@GARNET.BERKELEY.EDU Newsgroups: bionet.genome.arabidopsis Subject: Re: Immunofluorescence/in situ methods Message-ID: <199312071750.JAA18589@garnet.berkeley.edu> Date: 7 Dec 93 17:50:22 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 2 Thanks for the protocol! I'm off to give it a try. -marta From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!UMAIL.UMD.EDU!Paul_J_BOTTINO From: Paul_J_BOTTINO@UMAIL.UMD.EDU (pb23) Newsgroups: bionet.genome.arabidopsis Subject: Open Position at U Maryland Message-ID: <9312071721.AA17482@umailsrv0.UMD.EDU> Date: 7 Dec 93 17:21:00 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 23 The following advertisement will appear in the Dec 17 issue of Science. PLANT MOLECULAR GENETICS UNIVERSITY OF MARYLAND, COLLEGE PARK The Department of Botany invites applications for a 9.5 month, tenure-track position at the Assistant Professor level beginning August 1994. We are seeking someone who is investigating fundamental problems of development, physiology or metabolism through molecular genetic manipulation of a higher plant model, like Arabidopsis thaliana. The successful candidate is expected to develop a nationally recognized, externally funded research program, and to actively participate in the undergraduate and graduate curriculum. Candidates should have a Ph. D. degree and postdoctoral experience. For full consideration, completed applications should be received by February 15, 1994. Applicants should send curriculum vitae, statement of research goals and teaching interests, key reprints, and have three letters of reference sent to Dr. Heven Sze, Chair Geneticist Search Committee, Department of Botany, University of Maryland, College Park, MD 20742-5815. FAX:301-314-9082. The University of Maryland is an Affirmative Action/Equal Opportunity Employer, Women and minority candidates are encouraged to apply. From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!DUCVAX.AUBURN.EDU!TUZUN From: TUZUN@DUCVAX.AUBURN.EDU Newsgroups: bionet.genome.arabidopsis Subject: need an e-mail address Message-ID: <01H65IFZ20OG000W0H@DUCVAX.AUBURN.EDU> Date: 6 Dec 93 14:24:00 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 12 Dear netters, Does anyone have an e-mail address for L. Mark Lagrimini? I am a Ph.D. candidate interested in studying peroxidase gene regulation, especially as it relates to plant-pathogen interactions. Any information would be greatly appreciated. I can be contacted at: Peter Gay tuzun@ducvax.auburn.edu or pgay@ag.auburn.edu Phone: (205) 844-1962 Thanks in advance. Peter Gay From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!TIKAL.BIOSCI.ARIZONA.EDU!david_mount From: david_mount@TIKAL.BIOSCI.ARIZONA.EDU (David Mount) Newsgroups: bionet.genome.arabidopsis Subject: tenure track faculty positi Message-ID: <01H66Z60TP2Q9JEIMC@Arizona.EDU> Date: 7 Dec 93 09:34:06 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 33 Subject: Time:9:21 AM OFFICE MEMO tenure track faculty position Date:12/7/93 The following ad will appear in Nature in the December 9 issue and in Science, December 17 and 24 issues. Applications from researchers working on plant cell and developmental biology will be welcomed. David Mount. FACULTY POSITION AT THE UNIVERSITY OF ARIZONA As part of a continuing expansion, the Department of Molecular and Cellular Biology is seeking a new tenure-track faculty member at the Assistant Professor level for appointment in 1994. Preference will be given to applicants with research interests in the cellular or developmental biology of multicellular organisms, although exceptional candidates in other areas will be considered. Successful candidates will be expected to establish a competitive research program and to teach at both the undergraduate and graduate levels. Send curriculum vitae, a 1-2 page statement of research interests, and have at least three supporting letters sent to: Professor Samuel Ward, Head, Department of Molecular and Cellular Biology, Life Sciences South Building, Room 444, University of Arizona, Tucson, AZ 85721, USA. To ensure consideration, applications should be received by January 21, 1994, although applications will be accepted until the position is filled. The University of Arizona is an Equal Opportunity Affirmative Action Employer. Women and minorities are encouraged to apply. From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!JUDY.ENG.UCI.EDU!liang From: liang@JUDY.ENG.UCI.EDU (liang) Newsgroups: bionet.genome.arabidopsis Subject: CHINESES_BIOTECH_NET_FOUNDED Message-ID: <9312060500.AA19325@judy.eng.uci.edu> Date: 6 Dec 93 05:00:24 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 12 CBNet (Chinese Biotechnology Network) is a non-profit organization composed of professionals in biological, chemical, medical sciences, engineering and related fields. The CBNet sponsors the Chinese Biotechnology Internet Forum (CBIF) newsletter. To subscribe CBIF, please send an email to Listserv@UCSD.Edu with the message body: Add CB-Net. From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!daresbury!not-for-mail From: traas@tournesol.versailles.inra.fr (Jan Traas) Newsgroups: bionet.genome.arabidopsis Subject: Re: Immunofluorescence/in situ methods Message-ID: <2e1eg2$c1f@mserv1.dl.ac.uk> Date: 7 Dec 93 08:22:26 GMT Sender: daemon@mserv1.dl.ac.uk Distribution: bionet Lines: 100 Original-To: Arab-gen@dl.ac.uk > > I've had quite some requests for more details on the metacrylate embedding > procedure that is compatible with in situ and immunolabelling. Here is a > brief description of the method which follows more or less the one > described by Baskin et al. (Planta 187 (3) 405-414). The in situ method is > also described by Kronenberger, Desprez, Hofte, Caboche and Traas (1993) Cell > Biol.Int. (In press) > > Fixation of tissues: > > We fix whole seedlings or flower buds in 4% formaldehyde (fresh from > paraformaldehyde) in PIPES (or PBS) buffer on ice under vacuum for 20 min.The > plants are subsequently left in the fixative for at least 1hr at 4 C (or > even overnight). If a better ultrastructural preservation is required > glutaraldehyde (O.1 - O.5%) can be added. > > Embedding > > After fixation plants are washed in buffer and subsequently dehydrated in > an ethanol series (10 - 100% ethanol, 30 min- 1 hr per step). To the > ethanol DTT is added (1 mM for 10-70%, 10 mM 90-100%) which apparently > protects some antigenic sites, but which does not seem to be essential for > in situ hybridization. > After dehydration plants are passed through a metacrylate/ethanol series > and then through 3 changes of pure methacrylate, always in the presence of > 10 mM DTT. The methacrylate solution contains 80% butyl-metacrylate, > 20% methyl-metacrylate (Both from TAAB, U.K.),0.5% benzoin ethyl ether and > 10 mM DTT. The metacrylate is polymerized under UV and in the > absence of crosslinker at 4 C. For this purpose dissolved oxygen (which > inhibits polymerization) has to be replaced by bubbling gaseous nitrogen > through the solution (for 20 min.). The samples are transferred to molds > just before polymerization and covered with parafilm. The resin is > polymerized under UV. > > IMPORTANT: > We've had problems with uneven polymerization,brittle blocks, air bubbles, > and tissue distortion. Bubbles can be avoided by placing the UV light > source (6W) at 15 cm under the molds to start polymerization from the > bottom of the mold. Tissue distortion (due to uneven polymerization) > or brittle blocks can be avoided by placing several layers of parafilm (up > to 6) between the light source and the samples. In that case > polymerization can take up to 12 hr. > > Sectioning > > Metacrylate sections (2-10 microns) are cut (usually dry) using glass or > diamond knives. Semithin sections are floated on sterile water on > poly-L-lysine coated (multiwell) slides. After air drying the resin is > removed by a 15 min incubation in acetone and sections are rehydrated > through a 100-30% ethanol series and finally washed in 0.85% NaCl. > > In situ hybridization > > We use dig-labelled probes, labelled following Boehringer instructions. > Sections undergo the following pretreatments: after a wash in PBS sections > are treated with proteinase K (10 mg/ml) for 10 min. This greatly enhances > labelling, but apparently some batches of the enzyme contain significant > amounts of RNAse.We've had less problems with the prot. K powder than with > the ready for use solutions furnished by Boehringer.If necessary the > concentration can be lowered. After proteinase > treatment sections are incubated in 0.2% glycine (2 min) and postfixed in > formaldehyde (4% in PBS). After several washes the sections are treated > with O.5% acetic anhydride in 0.1 M triethanolamine (pH 8). This reduces background staining. At this stage sections can be dehydrated again and air dried. They can also be used > directly for in situ labelling. > The labelling itsself is fairly standard.We incubate overnight at 50 C. > After labelling sections are washed in 4XSSC, 2XSSC (with RNAse to reduce > background) and 0.1xSSC (at 50 C, 2X5 min) and PBS.Sections can then be > incubated with anti-dig antibody (we usually use phosphatase labelled > antibody). Chromogenic reaction is carried out for 1-12 hr, but I've been > told that in some cases it might be necessary to leave the preparations for > several days in the substrate. > > Immunolabelling > > This is carried out exactly as described in the Baskin et al paper. > > Remarks concerning whole mount in situ/immunolabelling: > > For whole mount in situ labelling of meristems and growing tissues we use > a method which is based on the Tautz procedure (Tautz and Pfeiffle, > Chromosoma 98: 81-85; see also:Ludevid et al. (1992): Plant Physiol. 100: > 1633-1639). This method is not reliable for the labelling of mature > tissues with thick walled cells. > Whole mount immuno labelling of seedlings has not been possible in our > hands. We have been successfull by using fixed plantlets that are split in > two (after cellulase treatment)longitudinally under the > dissecting microscope.The tissue fragments are attached to poly-L-lysine > coated coverslips and should not be air dried. For some antigens (e.g. > cytoskeleton) tissues can first be extracted in NP40 (O.1%) to reduce > background. For obervation a confocal microscope is essential... > > Again: Good luck! > > Jan Traas > INRA Biologie Cellulaire Route de Saint Cyr 78026 Versailles cedex, France From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!CS.Arizona.EDU!organpipe.uug.arizona.edu!uunet!decwrl!decwrl!waikato!comp.vuw.ac.nz!zephyr.grace.cri.nz!zephyr.grace.cri.nz!hrabjj From: hrabjj@marc.cri.nz Newsgroups: bionet.genome.arabidopsis Subject: test please ignore Message-ID: Date: 7 Dec 93 21:17:38 GMT Organization: Hort Research Lines: 1 NNTP-Posting-Host: 161.29.2.103 X-Newsreader: Trumpet for Windows [Version 1.0 Rev A] test From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!SALK-QM.SDSC.EDU!detlef_weigel From: detlef_weigel@SALK-QM.SDSC.EDU ("Detlef Weigel") Newsgroups: bionet.genome.arabidopsis Subject: Research Assistant at the S Message-ID: <9312072030.AA06264@net.bio.net> Date: 7 Dec 93 04:26:54 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 28 Subject: Time:12:22 OFFICE MEMO Research Assistant at the SALK Date:12/07/93 RESEARCH ASSISTANT POSITION AVAILABLE AT THE SALK INSTITUTE Our group studies early flower development in Arabidopsis using genetic and molecular approaches (see Cell 69, 843-859 [1992], and Science 261, 1723-1726 [1993]). Candidates for this position should have a B.A. or equivalent degree in biology or biochemistry and lab experience in molecular biology and/or plant tissue culture. Starting salary for the position, which is open immediately, is $ 23,800 p.a. with excellent benefits. The Salk Institute is located in an attractive environment in Southern California. Applications should include curriculum vitae, career goals and the phone numbers of referees. Inquiries should be addressed to: Detlef Weigel Plant Biology Laboratory The Salk Institute for Biological Studies P.O. Box 85800 San Diego, CA 92186-5800 Phone: (619) 453-4937 FAX: (619) 558-6379 Internet: Detlef_Weigel@qm.sdsc.edu From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!MACC.WISC.EDU!grheck From: grheck@MACC.WISC.EDU Newsgroups: bionet.genome.arabidopsis Subject: unspliced intron Message-ID: <23120715160033@vms2.macc.wisc.edu> Date: 7 Dec 93 21:17:13 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 12 Dear Netters, I recently sequenced a polyadenylated cDNA that had all but one of its introns spliced. At this point I do not have any reason to believe this is an important alternate form of the transcript under study. How frequently do people encounter such phenomena? Any information would be satisfying. Just curious, Greg Heck University of Wisconsin, Madison From owner-arabidopsis@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!kristoff From: kristoff@net.bio.net (David Kristofferson) Newsgroups: bionet.announce,bionet.molbio.methds-reagnts,bionet.genome.arabidopsis,bionet.jobs Subject: NET.BIO.NET News software upgrade still not successful 8-( Message-ID: Date: 7 Dec 93 18:59:34 GMT Organization: BIOSCI International Newsgroups for Biology Lines: 19 Approved: bionews-moderator@net.bio.net Xref: biosci bionet.announce:824 bionet.molbio.methds-reagnts:9706 bionet.genome.arabidopsis:1703 bionet.jobs:2892 Despite several attempts over the weekend, Monday, and until the early morning hours on Tuesday, a combination of software and hardware problems aborted our news software upgrade efforts. Kenton believes that he now has a solution, but we will be postponing another attempt possibly until next weekend. Consequently we have reverted back to the old news transport system temporarily. Some messages were duplicated yet again during the aborted attempts over the weekend, but the duplication problem should now be corrected for the interim. Our apologies for the inconvenience and my thanks to Kenton for sacrificing his weekend and staying till all hours of the night to work on this issue for the benefit of the community. Sincerely, Dave Kristofferson BIOSCI/bionet Manager biosci-help@net.bio.net From owner-arabidopsis@net.bio.net Tue Dec 07 22:00:00 1993 Path: biosci!biochem.umass.edu!jkreps From: jkreps@biochem.umass.edu Newsgroups: bionet.genome.arabidopsis Subject: Re: unspliced intron Message-ID: <01H68RSBDZG68Y6FDD@phobos.ucs.umass.edu> Date: 8 Dec 93 21:25:01 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 52 Return-path: Received: from rfd.ucs.umass.edu by phobos.ucs.umass.edu (PMDF V4.2-14 #2573) id <01H67DTHCBGW8Y5ABI@phobos.ucs.umass.edu>; Tue, 7 Dec 1993 16:34:33 -0500 Received: from DIRECTORY-DAEMON by rfd.ucs.umass.edu (PMDF V4.2-14 #2573) id <01H67DR3BAM8000S13@rfd.ucs.umass.edu>; Tue, 7 Dec 1993 16:32:23 -0500 Received: from net.bio.net by rfd.ucs.umass.edu (PMDF V4.2-14 #2573) id <01H67DR17H28000VWV@rfd.ucs.umass.edu>; Tue, 7 Dec 1993 16:32:21 -0500 Received: by net.bio.net (5.65/IG-2.0) id AA09304; Tue, 7 Dec 93 13:17:27 -0800 Received: from vms2.macc.wisc.edu by net.bio.net (5.65/IG-2.0) with SMTP id AA09279; Tue, 7 Dec 93 13:17:13 -0800 Received: from galifrey.botany.wisc.edu by vms2.macc.wisc.edu; Tue, 07 Dec 93 15:16 CDT Date: Tue, 07 Dec 1993 13:17:13 -0800 From: grheck@macc.wisc.edu Subject: unspliced intron To: arabidopsis@net.bio.net Message-id: <23120715160033@vms2.macc.wisc.edu> Content-transfer-encoding: 7BIT X-Sender: grheck@vms2.macc.wisc.edu Dear Netters, I recently sequenced a polyadenylated cDNA that had all but one of its introns spliced. At this point I do not have any reason to believe this is an important alternate form of the transcript under study. How frequently do people encounter such phenomena? Any information would be satisfying. Just curious, Greg Heck University of Wisconsin, Madison Dear Greg and the Net, We also isolated a cDNA which contained intron sequence. In our case only part of the intron (166 bp out 305) was retained within the cDNA. When we used the "intron-like" sequence to probe a northern, we found that the extra sequence was present in total RNA but at a very low level. Our intron- like sequence contained an in-frame stop-codon, so it is not clear what function it might have in vivo. We found consensus donor and acceptor sites flanking the intron-like sequence so we think that it is due to alternative splicing. Sincerely, Joel A. Kreps Anne Simon's lab, U. Mass. at Amherst From owner-arabidopsis@net.bio.net Tue Dec 07 22:00:00 1993 Path: biosci!daresbury!doc.ic.ac.uk!uknet!EU.net!howland.reston.ans.net!cs.utexas.edu!natinst.com!news.dell.com!swrinde!sgiblab!munnari.oz.au!ariel.ucs.unimelb.EDU.AU!ucsvc.ucs.unimelb.edu.au!lugb!lure.latrobe.edu.au!botjlh From: botjlh@lure.latrobe.edu.au Newsgroups: bionet.genome.arabidopsis Subject: Re: GUS stability Message-ID: <1993Dec7.194354.1@lure.latrobe.edu.au> Date: 7 Dec 93 09:43:54 GMT References: <9311300750.AA09477@nature.berkeley.edu.cnr-net> Sender: news@lugb.latrobe.edu.au (USENET News System) Distribution: bionet Organization: VAX Cluster, Computer Centre, La Trobe University Lines: 20 In article <9311300750.AA09477@nature.berkeley.edu.cnr-net>, djackson@NATURE.BERKELEY.EDU writes: > I'm trying to find an accurate estimate of the half life of GUS protein in > plant cells. I believe it is between one and three days; I am planning > experiments where this could cause some problems. Is anyone trying to > engineer a less stable form of the enzyme? > > David Jackson > USDA/UC Berkeley Plant Gene Expression Centre. Concerning the half life of the GUS protein in plant cells, Jefferson et al., reported it to be approximately 50 hours in living mesophyll protoplasts (p3904). Jefferson, R.A., Kavanagh, T.A. and Bevan, M.W. (1987). GUS fusions: B-glucuronidase as a sensitive and versatile gene fusion marker in higher plants. EMBO J. (6). pp3901-3907. Hope this helps, Joshua. From owner-arabidopsis@net.bio.net Tue Dec 07 22:00:00 1993 Path: biosci!cornell.edu!rll3 From: rll3@cornell.edu (Robert L. Last) Newsgroups: bionet.genome.arabidopsis Subject: Change of E-mail address Message-ID: <199312082233.AA03928@postoffice.mail.cornell.edu> Date: 8 Dec 93 22:33:47 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 7 Please note that my new internet address is: RLL3@CORNELL.EDU Rob Last Boyce Thompson Institute Cornell U. From owner-arabidopsis@net.bio.net Wed Dec 08 22:00:00 1993 Path: biosci!daresbury!doc.ic.ac.uk!warwick!uknet!pipex!uunet!olivea!spool.mu.edu!caen!batcomputer!ghost.dsi.unimi.it!genes!pongor From: pongor@genes.icgeb.trieste.it (Sandor Pongor) Newsgroups: bionet.genome.arabidopsis Subject: Mail server for protein functional domain homologies - ICGEB Trieste Keywords: mail server, molecular biology, protein domains, sequences Message-ID: <1993Dec9.100831.22451@genes.icgeb.trieste.it> Date: 9 Dec 93 10:08:31 GMT Organization: ICGEB Lines: 148 SS BBB A SS EEEE H H EEEE L PPP S S B B A A S S E H H E L P P S B B A A S E H H E L P P S BB AAAAA S EEE HHHHH EEE L PPP S B B A A S E H H E L P S B B A A S E H H E L P S S B B A A S S E H H E L P SSS BBB A A SSS EEEE H H EEEE LLLL P ---------------------------------- This is the help file of the SBASE Email Server at the International Centre for Genetic Engineering and Biotechnology AREA Science Park, Padriciano 99, 34012 Trieste, Italy. ---------------------------------- The SBASE Email Server is at present experimental. Please send comments to sbase-comment@icgeb.trieste.it. Thanks. The SBASE e-mail server accepts a specially formatted mail message containing a protein query sequence, and, as a response, it sends the list of the most probable domain homologies. A database search is performed against the SBASE library of protein domains using the BLAST algorithm, and the search results, provided with annotations, are returned in a mail message. How to use: Getting HELP: ============ This help file can be gotten by sending an email to sbase@icgeb.trieste.it containing the word HELP alone in the first line of the message body. Making a QUERY: =============== Send e-mail to sbase@icgeb.trieste.it using the below example Note: the parameters before the token BEGIN are optional, (here the defaults are listed), the lines after BEGIN are required. Example: MATRIX PAM120 SCORE PARAMETER 35 ANNOTATIONS YES BEGIN > mysequence LRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYG GLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYG Response time ============= Requests are handled immediately, in serial order. At present, response time is quite short and is restricted by the network load rather than CPU availability. Please note that large output files, such as sometimes occur with very short query sequences, may need a long time to traverse the net. Evaluation of the output: ========================= The output of the server are BLAST search results against the SBASE protein domain library. The output file contains the BLAST search results, organized as follows: 1) List of the best scoring domain entries. As SBASE entries are named by domain names (function, structure, etc.), this list already may give some information on the expected domain composition. 2) List of alignments. For each SBASE entry you will find the complete annotation of the domain, followed by one (or several) alignments with (different parts of) the query. If one domain is found several times in your query, you may find several alignments with the same or related entries at different parts of the query. Please note that it depends on the score parameter whether or not you see all the alignments. Do not use very low cutoff values because that results in prohibitively long output files. (For the time being, we have set the default cutoff to 35 and the minimum cutoff to 30). 3) Run statistics. This is usually not essential for the evaluation of the results; you can get a complete description of these and other blast parameters by sending a HELP message to blast.ncbi.nlm.nih.gov Important: Failure to see a homology with a known domain may be due to several reasons: i) The domain type is not (yet) included in the SBASE domain library; ii) The threshold score parameter was set too high for the domain to be detected; iii) A different scoring matrix may be necessary in order to detect the alignment with the domain type in question. In the present experimental version of the SBASE server we support only the matrices used by BLAST; "customized matrices" will be added later to the final version. Papers to reference in reporting results: ========================================= Pongor, S., Skerl, V., Cserzo, M. and Hatsagi, Z., Simon, G. and Bevilacqua, V. (1992): The SBASE domain library release 2.0& A collection of annotated protein sequence segments, Nucleic Acids. Res , 21, 311-315 Altschul, Stephen F., Warren Gish, Webb Miller, Eugene W. Myers, and David J. Lipman (1990) Basic local alignment search tool J. Mol. Biol. 215:403-410. Software availability ===================== The Sbase database is available by anonymous ftp at ftp.icgeb.trieste.it:/pub/sbase2 The blast software is available by anonymous ftp at ncbi.nlm.nih.gov:/pub/ Protection of your sequence data ================================ The query sequences are not stored in any form. Further info: ============= Server functions: Zsolt Hatsagi Tel: +39-40-3757342 Valeria Bevilacqua, systems manager (valeria@icgeb.trieste.it) Tel.: +39-40-3757330 General info: Sandor Pongor Tel: +39-40-3757300 FAX: +39-40-226-555 Mail: International Centre for Genetic Engineering and Biotechnology AREA Science Park, Padriciano 99 34012 Trieste, Italy From owner-arabidopsis@net.bio.net Wed Dec 08 22:00:00 1993 Path: biosci!MSU.EDU!21847CRS From: 21847CRS@MSU.EDU ("Chris.Somerville") Newsgroups: bionet.genome.arabidopsis Subject: Arabidopsis election:Please vote Message-ID: <9312091933.AA15571@net.bio.net> Date: 9 Dec 93 19:31:00 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 38 Many thanks to all those who nominated colleagues for membership on the North American Steering Committee. There is quite a long list of nominees (below). Please vote for two candidates by sending a message to the following address: arabvote@net.bio.net Voting will close December 21. The two names with the largest number of votes will be invited to join the committee. IN case of a tie there will be a runoff election as before. I have not attempted to contact all those nominated to see if they will accept the position if elected. Hopefully this will not be a problem. The nominees are: Barbara Baker Philip Benfey John Browse Clint Chapple Gloria Coruzzi Nigel Crawford Xing-Wang Deng Marc Estelle Ken Feldmann Gerry Fink Pam Green Roger Hangarter George Haughn Vivian Irish Rob Last Rich Meagher June Medford Bob Pruitt Pablo Scolnik Brenda Shirley Brian Staskawicz Mike Sussman Marty Yanofsky From owner-arabidopsis@net.bio.net Thu Dec 09 22:00:00 1993 Path: biosci!daresbury!not-for-mail From: PLZMLH@VAX.CCC.NOTTINGHAM.AC.UK Newsgroups: bionet.genome.arabidopsis Subject: Pest control update from NASC Message-ID: <2e9jtd$e2s@mserv1.dl.ac.uk> Date: 10 Dec 93 10:43:57 GMT Sender: daemon@mserv1.dl.ac.uk Distribution: bionet Lines: 53 Original-To: ARAB-GEN@dl.AC.UK To: ARAB-GEN From: Mary Anderson (NASC) Subject: CHEMICAL CONTROL OF PESTS AND DISEASES In our Seed List we carry information about the control of pests and diseases. Here is an update on this information for your files. Thrips: Fumigate with nicotine 40% shreds (DowElanco Ltd) or Lindane smoke pellets (Octavius Hunt Ltd) at 14 day intervals. If the infestation is severe fumigation may be carried out 3 times at 7 day intervals, although this may result in some scorching of the plants. Alternatively, granules of Temik 10G (Union Carbide, or Basudin 5G (Ciba-Geigy Agrochemicals) may be sprinkled around and watered in. Whitefly: Fumigate with Lindane smoke pellets (see above) or Propoxur smokes (Octavius Hunt Ltd). Sciarid (mushroom fly): Fumigate with Lindane smoke pellets or Nicotine 40% shreds (see thrips above) to eradicate flies and incorporate Basudin 5G granules into the compost to kill the larvae. *The compost and benches may also be drenched with a solution of Diazinon liquid (Murphy Chemicals Ltd) to eradicate the larvae. Addendum The chemical Diazinon previously used in the control of sciarid fly is no longer obtainable and the following regime is now used to control this pest. a) Biological control: Nemasys (koppert, UK Ltd) b) The plants, pots and benches are thoroughly drenched with a mixture of Nemolt (Applied Horticulture Ltd) and Savona (Koppert UK Ltd) Aphids: Fumigate with 40% nicotine shreds. Red Spider Mite: Fumigate with 40% nicotine shreds maintaining a temperature of 25C for at least 8 hours alternately the plants may be sprayed with Pentac Aquaflow (Dow Agriculture Ltd) or Savona (Koppert UK Ltd). Fungal Diseases: Spray or drench plants with a solution of Benlate systemic fungicide (ICI Ltd). Please observe the safety recommendations supplied with the products when handling these chemicals. From owner-arabidopsis@net.bio.net Thu Dec 09 22:00:00 1993 Path: biosci!SELWAY.UMT.EDU!lp From: lp@SELWAY.UMT.EDU (Ping Li) Newsgroups: bionet.genome.arabidopsis Subject: seeking help on flower/fruit abortion in Arabidopsishelp Message-ID: Date: 10 Dec 93 20:05:10 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 24 I am working on mutations of Arabidopsis thaliana and have found that first several flowers in most individual plants are unable to produce normal fruits. Those fruits usually are tiny or abort. Those flowers look like normal ones. Last week, I noticed that one individual plant doesn't produce any normal fruit, it has had lots flowers which look normal to me. The flower has lots pollens and ovules. But all the fruits are tiny and don't grow up, soon they die. Is there anyone can help me to find that why that happens? How to exam the causes? If you have any ideal about that, please help me. Thank you in advance! Li Ping Division of Biological Sciences The University of Montana Missoula, Montana 59812 E.Mail: lp@selway.umt.edu From owner-arabidopsis@net.bio.net Fri Dec 10 22:00:00 1993 Path: biosci!bcm!cs.utexas.edu!uunet!zib-berlin.de!fauern!news.dfn.de!scsing.switch.ch!urz.unibas.ch!bioftp.unibas.ch!embl-heidelberg.de!rainer-mac.embl-heidelberg.de!user From: Fuchs@EMBL-Heidelberg.DE (Rainer Fuchs) Newsgroups: bionet.genome.arabidopsis Subject: Re: Mail server for protein functional domain homologies - ICGEB Trieste Message-ID: Date: 10 Dec 93 16:47:59 GMT References: <1993Dec9.100831.22451@genes.icgeb.trieste.it> Followup-To: bionet.genome.arabidopsis,bionet.software Organization: EMBL Data Library Lines: 69 Nntp-Posting-Host: rainer-mac.embl-heidelberg.de In article <1993Dec9.100831.22451@genes.icgeb.trieste.it>, pongor@genes.icgeb.trieste.it (Sandor Pongor) wrote: > The SBASE e-mail server accepts a specially formatted mail message > containing a protein query sequence, and, as a response, it sends the list > of the most probable domain homologies. A database search is performed > against the SBASE library of protein domains using the BLAST algorithm, > and the search results, provided with annotations, are returned in a mail > message. > > > How to use: > Included below is a specification for this new service for use with my MSU (mail server utility) program. Just include it into SPECFILE. MSU can be obtained from ftp.embl-heidelberg.de (/pub/software/unix and /pub/software/vax). ### # SBASE Mail server # 10-Dec-1993 ### service-name: SBASE service-info: Protein domain detection service-addr: sbase@icgeb.trieste.it -- help-address: sbase@icgeb.trieste.it help-body: help // service-prot-options: start-token: BEGIN seq-format: FASTA -- msu-object: obj-name: Include annotation obj-info: Include complete annotation of domains in output obj-tag: ANNOTATIONS obj-class: Group elements: 2 def: 1 items: YES, NO -- msu-object: obj-name: Scoring matrix obj-info: Scoring matrix applied for sequence comparisons obj-tag: MATRIX obj-class: Group elements: 5 def: 1 items: PAM120, PAM250, PAM40, BLOSUM60, BLOSUM80 -- msu-object: obj-name: Cutoff score obj-info: Cutoff score for displaying homologies obj-tag: SCORE PARAMETER obj-class: Int min: 30 max: 100 def: 35 -- Rainer Fuchs EMBL Data Library Fuchs@EMBL-Heidelberg.DE From owner-arabidopsis@net.bio.net Mon Dec 13 22:00:00 1993 Path: biosci!U.WASHINGTON.EDU!stardog From: stardog@U.WASHINGTON.EDU (Kevin Lease) Newsgroups: bionet.genome.arabidopsis Subject: I would like to subscribe Date: 13 Dec 1993 15:30:50 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 11 Sender: daemon@net.bio.net Distribution: bionet Message-ID: Hi, I am interested in subscribing to your newsletter. Thanks, Kevin Lease My address is: stardog @u.washington.edu From owner-arabidopsis@net.bio.net Mon Dec 13 22:00:00 1993 Path: biosci!MSU.EDU!22313TCN From: 22313TCN@MSU.EDU ("Thomas_C.Newman") Newsgroups: bionet.genome.arabidopsis Subject: MSU-ESTs Date: 13 Dec 1993 16:05:02 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 1889 Sender: daemon@net.bio.net Distribution: bionet Message-ID: <9312140004.AA00853@net.bio.net> 12/13/93 MSU Arabidopsis ESTs Page 1 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ b79xp 1759 t14317 35300 42e12t7 2029 t13864 34847 %0S RIBOSOMAL PROTEIN L14A. >p 186 37b10t7 1383 t13317 34300 *GTP-binding protein alpha-13 57 23f8t7 1121 t13055 34038 .falciparum parasite antigen r 66 B63XP 1728 T14286 35269 02-EVOLVING ENHANCER PT-2 296 49a11t7 2348 t14183 35166 0XYSTEROL-BINDING PROTEIN. >pi 98 23d3t7 1109 t13043 34026 1 protein - Yeast (Schwanniomy 60 43a11t7 2048 t13883 34866 14 KD PROTEIN. >gp|X15436|DC21 178 49f4t7 2366 t14201 35184 14 KD PROTEIN. >gp|X15436|DC21 61 23g10t7 1794 t13629 34612 14-3-3-LIKE PROTEIN. >sp|P2930 316 43c12t7 2064 t13899 34882 14-3-3-LIKE PROTEIN. >sp|P2930 234 49a10t7 2347 t14182 35165 190 KD ANTIGEN PRECURSOR (CELL 56 42g6t7 2043 t13878 34861 2,3-bisphosphoglycerate-indepe 461 43g7t7 2097 t13932 34915 2-5A-dependent RNase [Homo sap 62 33D5T7 1227 T13161 34144 2-OXOIXOVALERATE DEHYDROGENASE 423 46f11t7 2247 t14082 35065 205K microtubule-associated pr 69 47h6t7 2303 t14138 35121 206 gene product [Escherichia 76 48h11t7 2345 t14180 35163 22 KD CALMODULIN-LIKE CALCIUM- 392 39f3t7 1935 t13770 34753 23S rRNA gene product [Leptosp 54 42c9t7 2021 t13856 34839 241k polyprotein [Apple stem g 65 37h8t7 1899 t13734 34717 26S protease subunit 4 - human 183 48a5t7 2313 t14148 35131 2B histone - Maize | 0.0 0.0 0 246 43c10t7 2062 t13897 34880 2C PROTEIN. >pir|S08137|S08137 58 39d2t7 1929 t13764 34747 2S seed storage protein - Arab 200 38g6t7 1926 t13761 34744 3-HYDROXY-3-METHYLGLUTARYL-COE 348 35H10T7 1312 T13246 34229 3-ISOPROPYLMALATE DEHYDRATASE 170 32f9t7 1814 t13649 34632 3-ISOPROPYLMALATE DEHYDROGENAS 386 SCD3T7P 1006 T12940 33923 3-KETOACYL-COA THIOLASE PEROXI 99 39H3T7 1516 T13450 34433 3-KETOACYL-COA THIOLASE PEROXI 93 45g4t7 2206 t14041 35024 3-OXOACYL-[ACYL-CARRIER-PROTEI 67 48c3t7 2326 t14161 35144 30S RIBOSOMAL PROTEIN S7. >pir 56 48c10t7 2322 t14157 35140 31 kDa RNA binding protein [Ar 265 44e2t7 2139 t13974 34957 36-kDa vacuolar H+-ATPase memb 149 37g4t7 1893 t13728 34711 37 KD CHLOROPLAST INNER ENVELO 212 38G4T7 1454 T13388 34371 4-NITROPHENYLPHOSPHATASE 125 SBG10T7P 964 T12898 33881 40S RIBOSOMAL PROTEIN S13 509 36B11T7 1322 T13256 34239 40S RIBOSOMAL PROTEIN S6 399 31D8T7 1174 T13108 34091 40S RIBOSOMAL PROTEIN S8 314 47a11t7 2264 t14099 35082 40S ribosomal protein S13 - Ar 509 45e4t7 2194 t14029 35012 50S RIBOSOMAL PROTEIN L16 (RIB 311 37b1t7 1386 t13320 34303 50S RIBOSOMAL PROTEIN L19E (VE 397 4F4T7P 1627 T13561 34544 50S RIBOSOMAL PROTEIN L23 501 23a7t7 1090 t13024 34007 50S RIBOSOMAL PROTEIN L24 CHLO 317 48c11t7 2323 t14158 35141 50S RIBOSOMAL PROTEIN L3. >pir 82 23B12T7 1094 T13028 34011 50S RIBOSOMAL PROTEIN L6 246 SCD10T7P 1001 T12935 33918 50S RIBOSOMAL PROTEIN L9 173 12/13/93 MSU Arabidopsis ESTs Page 2 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 43d2t7 2074 t13909 34892 50S RIBOSOMAL PROTEIN S3 (S1A) 456 46e12t7 2240 t14075 35058 50S RIBOSOMAL PROTEIN S6. >pir 251 11B4T7P 1045 T12979 33962 6-PHOSPHOGLUCONATED DH 99 42b9t7 2013 t13848 34831 60S RIBOSOMAL PROTEIN L12. >pi 334 42H8T7 1613 T13547 34530 60S RIBOSOMAL PROTEIN L14A 206 31A8T7 1155 T13089 34072 60S RIBOSOMAL PROTEIN L19 506 40A4T7 1539 T13473 34456 60S RIBOSOMAL PROTEIN L27A 472 4B8T7P 1619 T13553 34536 60S RIBOSOMAL PROTEIN L3 594 49h5t7 2371 t14206 35189 60S RIBOSOMAL PROTEIN L5A. >pi 324 41g11t7 1998 t13833 34816 60S RIBOSOMAL PROTEIN L7A-2 (L 58 34e7t7 1839 t13674 34657 60S RIBOSOMAL PROTEIN L8. >pir 290 37H6T7 1419 T13353 34336 60S RIBOSOMAL PROTEIN L9 204 SBC9T7P 934 T12868 33851 60S RIBOSOMAL PROTEIN YL39 78 SCF11T7P 1017 T12951 33934 60S RIBOSOMAL PROTEIN YL41 101 43f10t7 2085 t13920 34903 60S ribosomal protein L27A - A 472 48b11t7 2316 t14151 35134 69 KD PROTEIN. >pir|JQ0110|JQ0 60 23c2t7 1785 t13620 34603 7K protein [Poplar mosaic viru 58 37A6T7 1381 T13315 34298 80K ANTIGEN 71 2C12T7P 1134 T13068 34051 ? 87 3D5T7 1527 T13461 34444 ? 71 41A5T7 1599 T13533 34516 ? 71 7C5T7P 1665 T13599 34582 ? 70 SBC8 933 t12867 33850 ? 70 3G2T7P 1531 T13465 34448 ? 68 B69TP 1739 T14297 35280 ? 65 SCE10T7P 1008 T12942 33925 ? 64 SCE12T7P 1010 T12944 33927 ? 64 6E2T7P 1658 T13592 34575 ? 63 B88XP 1773 T14331 35314 ? 63 SCF12T7P 1018 T12952 33935 ? 63 2B4T7P 1132 T13066 34049 ? 62 8A6T7P 1667 T13601 34584 ? 62 SCC9T7P 1000 T12934 33917 ? 62 1A4T7P 1058 T12992 33975 ? 61 1D4T7P 1062 T12996 33979 ? 61 1G12T7P 1065 T12999 33982 ? 60 2C11T7P 1133 T13067 34050 ? 60 B106XP 1684 T14242 35225 ? 60 B74TP 1750 T14308 35291 ? 60 SCA9T7P 985 T12919 33902 ? 60 6D4T7P 1656 T13590 34573 ? 58 B128XP 1695 T14253 35236 ? 58 SCH7T7P 1038 T12972 33955 ? 58 2F4T7P 1142 T13076 34059 ? 57 8A8T7P 1668 T13602 34585 ? 57 B125XP 1693 T14251 35234 ? 57 B74XP 1751 T14309 35292 ? 57 12/13/93 MSU Arabidopsis ESTs Page 3 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ B76XP 1755 T14313 35296 ? 57 1F1T7P 1064 T12998 33981 ? 56 2B12T7P 1131 T13065 34048 ? 56 3D8T7P 1528 T13462 34445 ? 56 B114RP 1688 T14246 35229 ? 56 B45TP 1703 T14261 35244 ? 56 2D1T7P 1137 T13071 34054 ? 55 B89TP 1775 T14333 35316 ? 55 4B12T7P 1616 T13550 34533 ? 54 B96XP 1779 T14337 35320 ? 54 1G5T7P 1067 T13001 33984 ? 53 SCC11T7P 995 T12929 33912 ? 53 SCF10T7P 1016 T12950 33933 ? 53 B98XP 1780 T14338 35321 ? 48 32A12T7 1197 T13131 34114 ? 40S RIBOSOMAL PROTEIN S22 58 4D3T7P 1622 T13556 34539 ? 6-PHOSPHOFRUCTO-2-KINASE 59 32C3T7 1210 T13144 34127 ? A1 GENE 57 31C12T7 1165 T13099 34082 ? APOCYTOCHROME B 64 SBH12T7P 973 T12907 33890 ? ASPARTIC ACID RICH PROTEIN 65 SBF10T7P 954 T12888 33871 ? ASPARTIC ACID RICH PROTEIN 58 33F11T7 1231 T13165 34148 ? ASPARTIC ACID RICH PROTEIN 55 11A9T7P 1043 T12977 33960 ? ASPARTIC ACID-RICH PROTEIN 65 32C12T7 1208 T13142 34125 ? ATP SYNTHASE DELTA CHAIN 60 SBC1T7P 929 T12863 33846 ? ATP10 60 SBE9T7P 953 T12887 33870 ? AUTOANTIGEN SNRNP SM-D 58 SCF1T7P 1019 T12953 33936 ? BCD PROTEIN 55 31E6T7 1179 T13113 34096 ? BETA 1,4-D-GLUCANASE 59 31G3T7 1186 T13120 34103 ? BW4 GENE 65 SBA9T7P 915 T12849 33832 ? CALPHOTIN 60 5G4T7P 1651 T13585 34568 ? CAPSID PROTEIN 59 SBB3T7P 920 T12854 33837 ? CAPSID PROTEIN C 53 32B10T7 1202 T13136 34119 ? CAPSID PROTEIN P40 60 SCE4T7P 1013 T12947 33930 ? CARBONYL REDUCTASE 65 31H3T7 1193 T13127 34110 ? CELLULASE E5 61 31G7T7 1189 T13123 34106 ? CHORION PROTEIN 60 SCB3T7P 991 T12925 33908 ? COAT PROTEIN 62 11A10T7P 1041 T12975 33958 ? COMPLEMENT C1Q CHAIN 58 31G8T7 1190 T13124 34107 ? CYTOCHROM P450 60 4B2T7P 1617 T13551 34534 ? CYTOCHROME B 60 3B9T7P 1525 T13459 34442 ? CYTOCHROME C OXIDASE 65 4F2T7P 1626 T13560 34543 ? CYTOCHROME C OXIDASE 62 SCF4T7P 1022 T12956 33939 ? CYTOCHROME C OXIDASE I 62 11C4T7P 1048 T12982 33965 ? CYTOPLASMIC FILAMENT PROTEIN 58 SBF6T7P 961 T12895 33878 ? DELTA ENDOTOXIN 59 SCH3T7P 1037 T12971 33954 ? DNA BINDING PROTEIN PRDII-BF 60 31E7T7 1180 T13114 34097 ? DNA POLYMERASE 62 23C8T7 1106 T13040 34023 ? DNAK PROTEIN 72 12/13/93 MSU Arabidopsis ESTs Page 4 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ SBD7T7P 944 T12878 33861 ? ENV POLYPROTEIN 61 9C1T7P 1680 T13614 34597 ? FCB GENES 60 8G5T7P 1676 T13610 34593 ? FILAGGRIN 57 5D6T7P 1644 T13578 34561 ? FRAGILE X PROTEIN 60 32C10T7 1206 T13140 34123 ? GAG POLYPROTEIN 61 SBA6T7P 913 T12847 33830 ? GAG PROTEIN SIMIAN FOAMY VIR 67 SBB9T7P 925 T12859 33842 ? GAMMA E CRYSTALLIN 59 11C10T7P 1046 T12980 33963 ? GENOME POLYPROTEIN (POLIO) 65 11A1T7P 1042 T12976 33959 ? GIANT LENS PROTEIN 62 SBC12T7P 928 T12862 33845 ? GLUTELIN 52 5B10T7P 1641 T13575 34558 ? GUANINE NUCLEOTIDE DISSOCIAT 59 SBA10T7P 905 T12839 33822 ? HEMAGGLUTININ-NEURAMINIADASE 54 SCC4T7P 998 T12932 33915 ? HERPESVIRUS 65 4G3T7P 1628 T13562 34545 ? HYPOTHETICAL PROTEIN 58 SBA8T7P 914 T12848 33831 ? HYPOTHETICAL PROTEIN 58 31C4T7 1168 T13102 34085 ? HYPOTHETICAL PROTEIN 57 6G3T7P 1662 T13596 34579 ? HYPOTHETICAL PROTEIN 57 32C4T7 1211 T13145 34128 ? HYPOTHETICAL PROTEIN 42K 63 32A6T7 1200 T13134 34117 ? HYPOTHETICAL PROTEIN F-327 67 32D8T7 1218 T13152 34135 ? HYPOTHETICAL S/T PROTEASE 67 31E1T7 1177 T13111 34094 ? IG HEAVE CHAIN C 65 32A11T7 1196 T13130 34113 ? INNER MEMBRANE PROTEIN 57 23E10T7 1113 T13047 34030 ? INTERLEUKIN 4 RECEPTOR 58 SCA3T7P 984 T12918 33901 ? L-FUCOSE PERMEASE 64 SBC10T7P 926 T12860 33843 ? LARGE T-ANTIGEN 58 SBG9T7P 972 T12906 33889 ? LARGE TEGUMENT PROTEIN 59 SBD4T7P 941 T12875 33858 ? LEGUME-LIKE STORAGE PROTEIN 57 SBG12T7P 966 T12900 33883 ? LIS 137 PROTEIN 62 SCD2T7P 1005 T12939 33922 ? MAJOR CAPSID PROTEIN 66 11D5T7P 1049 T12983 33966 ? MELANOTRANSFERRIN PRECURSOR 59 SBE8T7P 952 T12886 33869 ? MESA 58 SCE1T7P 1011 T12945 33928 ? METALLOTHEONEIN I 62 SBA1T7P 908 T12842 33825 ? METHIONYL-TRNA SYNTHETASE 56 SBC5T7P 931 T12865 33848 ? MINOR ENDOGLUCANASE Y 58 SCC1T7P 997 T12931 33914 ? MITOCHONDRIAL COMPONENT 65 SBH2T7P 975 T12909 33892 ? MITOCHONDRIAL DNA 52 SCH12T7P 1035 T12969 33952 ? MRUF2 GENE PRODUCT 58 23E8T7 1116 T13050 34033 ? MYOSIN 68 23B10T7 1092 T13026 34009 ? MYOSIN II 59 4H7T7P 1631 T13565 34548 ? NADH DH SUBUNIT 5 55 5E7T7P 1647 T13581 34564 ? NADH DH SUBUNIT 6 65 SCD1T7P 1004 T12938 33921 ? NADH-PLASTOQUINONE 62 SBG1T7P 967 T12901 33884 ? NADH-UBIQUINONE OXIDOREDUCT 56 SBF12T7P 956 T12890 33873 ? NADH-UBIQUINONE OXIDOREDUCTA 59 SBB1T7P 918 T12852 33835 ? NEGATIVE FACTOR HIV 61 SCG3T7P 1030 T12964 33947 ? NIFQ PROTEIN 59 SCA2T7P 983 T12917 33900 ? OMP DECARBOXYLASE 62 12/13/93 MSU Arabidopsis ESTs Page 5 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 23A6T7 1089 T13023 34006 ? ORF 65 31B12T7 1157 T13091 34074 ? ORF 63 SCA1T7P 982 T12916 33899 ? ORF 62 SBG11T7P 965 T12899 33882 ? ORF 61 3D1T7P 1526 T13460 34443 ? ORF 60 SCF8T7P 1023 T12957 33940 ? ORF 57 SBH1T7P 974 T12908 33891 ? ORF 56 6G7T7P 1663 T13597 34580 ? ORF2216 60 32D2T7 1216 T13150 34133 ? OUTER MEMBRANE COBALAMIN T 62 31B9T7 1164 T13098 34081 ? PEPSIN INHIBITOR-LIKE PROTEI 67 31D11T7 1172 T13106 34089 ? PEREGRIN 59 SBB11T7P 917 T12851 33834 ? PHOTOSYSTEM I P700 CHLOROPH 58 31F4T7 1181 T13115 34098 ? PHYCOBILIPROTEIN 59 SBG4T7P 970 T12904 33887 ? POLYCOMB PROTEIN 54 31C8T7 1170 T13104 34087 ? PPLZ02 PROTEIN 68 SBB4T7P 921 T12855 33838 ? PRIMORDIA PROTEIN TRANSCRIPT 61 SBE7T7P 951 T12885 33868 ? PROTEIN KINASE BCK1 60 SBA4T7P 911 T12845 33828 ? PRRB PROTEIN 60 SBE1T7P 947 T12881 33864 ? REG PROTEIN 63 6E10T7P 1657 T13591 34574 ? RHODOPSIN/BETA-ADRENERGIC RE 64 6D3T7P 1655 T13589 34572 ? RHODOPSIN/BETA-ADRENERGIC RE 63 23A5T7 1088 T13022 34005 ? RHSA PROTEIN 54 31B1T7 1158 T13092 34075 ? SEED mRNA 62 20C9T7 1079 T13013 33996 ? SM24 60 9B4T7P 1678 T13612 34595 ? SOR GENE 61 SCH10T7P 1033 T12967 33950 ? SP1 PROTEIN 58 31A1T7 1152 T13086 34069 ? SPORE COAT SP70 57 8C2T7P 1671 T13605 34588 ? TENASCIN 53 3A7T7P 1524 T13458 34441 ? THYROGLOBULIN 56 SBE6T7P 950 T12884 33867 ? TRANSACTING FACTOR C 58 SBA5T7P 912 T12846 33829 ? TRANSCRIPTIONAL ACTIVATOR 62 4B3T7P 1618 T13552 34535 ? TRANSPOSASE 60 5F3T7P 1649 T13583 34566 ? TRANSPOSON 65 31D10T7 1171 T13105 34088 ? TROPONIN T 64 2H6T7P 1150 T13084 34067 ? U1 SNRP 70 KD 60 23B4T7 1096 T13030 34013 ? VACUOLAR SORTING PROTEIN 1 59 23G7T7 1123 T13057 34040 ? VISININ 61 23C11T7 1100 T13034 34017 ? VITELLOGENIN 72 SCG2T7P 1029 T12963 33946 ? YEAST DNA 59 42A3T7 1604 T13538 34521 ?- PROTEIN UL53 60 38B3T7 1425 T13359 34342 ?-150 KD DYNEIN-ASSOCIATED PRO 58 40F8T7 1584 T13518 34501 ?-26S RNA 57 B44TP 1702 T14260 35243 ?-2HYDOXYLSOFLAVONE REDUCTASE 74 33F7T7 1235 T13169 34152 ?-50S RIBOSOMAL L18 60 40E3T7 1571 T13505 34488 ?-6'-AMINOGLYCOSIDE N-ACETYLTR 52 36D6T7 1338 T13272 34255 ?-ALPHA ENOLASE 58 SCB9T7P 993 T12927 33910 ?-ALU 55 12/13/93 MSU Arabidopsis ESTs Page 6 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 3E10T7P 1529 T13463 34446 ?-ATS1 64 S26T7P 894 T12828 33811 ?-AXONIN 61 B83XP 1763 T14321 35304 ?-BETA GALACTOSIDASE 52 37D6T7 1401 T13335 34318 ?-BETA-AMYLASE 63 40F6T7 1583 T13517 34500 ?-C-REL PROTO-ONCOGENE PROTEIN 62 39F12T7 1503 T13437 34420 ?-CADHERIN RELATED TUMOR SUPPR 62 39C4T7 1484 T13418 34401 ?-CALCITONIN RECEPTOR 58 37E8T7 1410 T13344 34327 ?-CALDESMON 58 37H1T7 1415 T13349 34332 ?-CAMP-DEPENDENT PROTEIN KINAS 54 40F5T7 1582 T13516 34499 ?-CARBAMOYL-PHOSPHATE SYNTHASE 55 40H11T7 1591 T13525 34508 ?-CARBOXYPEPTIDASE A2 63 37A2T7 1379 T13313 34296 ?-CELL ADHESION MOLECULE 63 34D11T7 1262 T13196 34179 ?-CELL ADHESION MOLECULE 59 40C3T7 1553 T13487 34470 ?-CELL DIVISION CONTROL (KAR1) 62 39H9T7 1521 T13455 34438 ?-CELL DIVISION CONTROL PROTEI 56 B86TP 1767 T14325 35308 ?-CHOLINE KINASE 57 37B8T7 1389 T13323 34306 ?-CHROMOGRANIN B 59 38G1T7 1453 T13387 34370 ?-CLB4 64 39H2T7 1515 T13449 34432 ?-CYCLIC NUCLEOTIDE PHOSPHODIE 58 40C5T7 1555 T13489 34472 ?-CYTOCHROME B6-F COMPLEX 51 36E1T7 1344 T13278 34261 ?-CYTOCHROME C OXIDASE POLYPEP 61 37A3T7 1380 T13314 34297 ?-CYTOCHROME OXIDASE 57 40D9T7 1566 T13500 34483 ?-DEL 58 39E10T7 1496 T13430 34413 ?-DINITROGENASE REDUCTASE 55 38B5T7 1427 T13361 34344 ?-DNA PACKAGING PROTEIN GP16 56 36D9T7 1341 T13275 34258 ?-DNA PLYMERASE BETA CHAIN 61 39A10T7 1466 T13400 34383 ?-DNA POLYMERASE 64 37C9T7 1398 T13332 34315 ?-DNA POLYMERASE 52 34B5T7 1253 T13187 34170 ?-DNA TOPOISOMERASE II 63 39D8T7 1494 T13428 34411 ?-DNA-BINDING PROTEIN 63 38H5T7 1461 T13395 34378 ?-DNA-DIRECTED RNA POLYMERASE 67 39A8T7 1472 T13406 34389 ?-E GENE PRODUCT (BACTERIOPHAG 75 34A10T7 1244 T13178 34161 ?-E7 PROTEIN 59 36F9T7 1358 T13292 34275 ?-ECDYSONE-INDUCED PROTEIN 62 40D5T7 1563 T13497 34480 ?-ECDYSONE-INDUCIBLE PT E75 65 40H8T7 1596 T13530 34513 ?-ELONGATION FACTOR 3 62 36H9T7 1376 T13310 34293 ?-ENVELOPE GLYCOPROTEIN GP340 64 38F1T7 1450 T13384 34367 ?-FDP1 SUPPRESSOR 62 39B11T7 1474 T13408 34391 ?-FINGER PROTEIN 54 50C9T7 1636 T13570 34553 ?-FORK HEAD PROTEIN 56 39D11T7 1489 T13423 34406 ?-FRAGILE X BREAKPOINT FMR1 65 33F3T7 1234 T13168 34151 ?-GENOME POLYPROTEIN 57 B43TP 1701 T14259 35242 ?-GF14 (AT) 68 50B10T7 1634 T13568 34551 ?-GLUCAN ENDO-1,3-BETA-GLUCOSI 23 35E7XP 1305 T13239 34222 ?-GLUCOSE TRANSPORTER PROTEIN 60 36E9T7 1348 T13282 34265 ?-GLUTAMATE RECEPTOR CHANNEL 63 S15ATM 889 T12823 33806 ?-GLUTAREDOXIN 66 12/13/93 MSU Arabidopsis ESTs Page 7 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 42H12T7 1612 T13546 34529 ?-GLUTATIONE REDUCTASE 57 S7ATM 904 T12838 33821 ?-GLYCINE RICH CELL WALL 57 38C4XP 1432 T13366 34349 ?-GLYCOGEN PHOSPHORYLASE 43 B130XP 1697 T14255 35238 ?-GTP BINDING PROTEIN GL1 60 40G11T7 1950 T13785 34768 ?-H+-TRANSPORTING ATP SYNTHASE 62 36D4T7 1337 T13271 34254 ?-HEAT SHOCK 70 KD PROTEIN 65 B67TP 1737 T14295 35278 ?-HEMAGGLUTININ 72 34F3T7 1271 T13205 34188 ?-HEMOGLOBIN 63 37D8T7 1402 T13336 34319 ?-HEMOGLOBIN 55 40E6T7 1574 T13508 34491 ?-HFLK PROTEIN 65 40D7T7 1564 T13498 34481 ?-HMG-Y-RELATED PROTEIN 64 40B2T7 1546 T13480 34463 ?-HOMEOTIC PROTEIN 60 39D12T7 1490 T13424 34407 ?-HYDROGENASE 56 36B3T7 1325 T13259 34242 ?-HYPOTHETICAL GENE 56 PROTEIN 61 40D2T7 1561 T13495 34478 ?-ICAM-1 62 37E12T7 1405 T13339 34322 ?-IG GERMLINE D-J-C REGION 60 39A2T7 1468 T13402 34385 ?-IMMEDIATE-EARLY PROTEIN 63 40C10T7 1550 T13484 34467 ?-IMMUNOGLOBIN 57 36H2T7 1371 T13305 34288 ?-INOSITOL 1,4,5-TRIPHOSPHATE 61 35B9T7 1293 T13227 34210 ?-INSULIN GROWTH FACTOR BINDIN 63 40E10T7 1567 T13501 34484 ?-KNOB PROTEIN (HISTIDINE RICH 62 B57TP 1715 T14273 35256 ?-LAMININ PERCURSOR 56 36F7T7 1356 T13290 34273 ?-LAR PROTEIN 57 40H3T7 1593 T13527 34510 ?-LIPOPROTEIN LIPASE 65 B122XP 1692 T14250 35233 ?-LUCIFERASE GENE 77 39E3T7 1498 T13432 34415 ?-M PROTEIN 62 39H12T7 1513 T13447 34430 ?-MALATE DEHYDROGENASE 61 39C8T7 1486 T13420 34403 ?-MALT REGULATORY PROTEIN 65 37E11T7 1404 T13338 34321 ?-MALTOSE TRANSPORT INNER MEM 55 34G4T7 1279 T13213 34196 ?-MANNOSE-1-PHOSPHATE GUANYLYL 61 36E3T7 1345 T13279 34262 ?-MATRIX PROTEIN M2 65 36G9T7 1368 T13302 34285 ?-METAPYROCATECHASE 1 55 37E3T7 1406 T13340 34323 ?-METHIONINE RICH STORAGE PROT 56 B82XP 1761 T14319 35302 ?-MOBC 63 36B2T7 1324 T13258 34241 ?-MOBILITY GROUP PROTEIN 63 35B4T7 1292 T13226 34209 ?-MOESIN-EZRIN-RADIXIN 63 33G11T7 1236 T13170 34153 ?-MUCIN 65 38E10T7 1439 T13373 34356 ?-MULTIDRUG RESISTANCE 59 35H2T7 1314 T13248 34231 ?-MURINE LEUKEMIA VIRUS 66 40A5T7 1540 T13474 34457 ?-MYCOCEROSIC ACID SYNTHASE 59 38D4T7 1436 T13370 34353 ?-MYOSIN 58 37B2T7 1387 T13321 34304 ?-NADH DEHYDROGENASE 60 40B8T7 1549 T13483 34466 ?-NADH DEHYDROGENASE CHAIN 1 58 42G10T7 1608 T13542 34525 ?-NADH-PLASTOQUINONE OXIDOREDU 59 36D8T7 1340 T13274 34257 ?-NADH-UBIQUINON OXIDOREDUCTAS 58 SCG7T7P 1031 T12965 33948 ?-ND7 57 40B10T7 1542 T13476 34459 ?-NED GENE 56 12/13/93 MSU Arabidopsis ESTs Page 8 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 39A9T7 1473 T13407 34390 ?-NEUROFILAMENT TRIPLET M PROT 64 37H5T7 1418 T13352 34335 ?-NEUROVIRULENCE FACTOR 67 3H8T7P 1535 T13469 34452 ?-NEUTRAL PREOTEINASE II 56 38G7T7 1455 T13389 34372 ?-NONE 0 50A9T7 1633 T13567 34550 ?-NONE 50B7T7 1635 T13569 34552 ?-NONE 39F9T7 1506 T13440 34423 ?-NUCLEAR PORE COMPLEX PROTEIN 62 39A7T7 1471 T13405 34388 ?-NUCLEOCAPSID PROTEIN B61TP 1723 T14281 35264 ?-NUCLEOLAR PHOSPHOPROTEIN B23 57 B76TP 1754 T14312 35295 ?-ORF 88 B50TP 1708 T14266 35249 ?-ORF 78 39G10T7 1507 T13441 34424 ?-ORF 68 34F9T7 1274 T13208 34191 ?-ORF 66 B65TP 1733 T14291 35274 ?-ORF 64 37C3T7 1395 T13329 34312 ?-ORF 63 38E7T7 1449 T13383 34366 ?-ORF 63 B49TP 1707 T14265 35248 ?-ORF 62 B75XP 1753 T14311 35294 ?-ORF 60 34D7T7 1264 T13198 34181 ?-ORF 58 B8TP 1776 T14334 35317 ?-ORF 58 34B4T7 1252 T13186 34169 ?-ORF 57 B52TP 1709 T14267 35250 ?-ORF 57 B60XP 1722 T14280 35263 ?-ORF 57 B85XP 1766 T14324 35307 ?-ORF 57 37D3T7 1400 T13334 34317 ?-ORF 56 B60TP 1721 T14279 35262 ?-ORF 56 38H2XP 1460 T13394 34377 ?-ORF 51 2E3T7P 1139 T13073 34056 ?-ORF-RFB GENE CLUSTER 69 36E7T7 1347 T13281 34264 ?-PEPTIDE CHAIN RELEASE FACTOR 60 40C8T7 1558 T13492 34475 ?-PKX2 PROTEIN KINASE 51 40E4T7 1572 T13506 34489 ?-PLACENTAL PROLACTIN-LIKE PRO 57 37D9T7 1403 T13337 34320 ?-POLYUBIQUITIN 64 38A6T7 1423 T13357 34340 ?-POTASSIUM TRANSPORT PROTEIN 58 40D8T7 1565 T13499 34482 ?-PROBABLE E5 PROTEIN 61 37B4T7 1388 T13322 34305 ?-PROEIN F3 63 S36ATM 898 T12832 33815 ?-PROTAMINE 65 2G12T7P 1145 T13079 34062 ?-PROTEIN G3 61 34B2T7 1251 T13185 34168 ?-PROTEIN KINASE 58 39F11T7 1502 T13436 34419 ?-PROTEIN KINASE 1 56 34B9T7 1256 T13190 34173 ?-PROTEIN KINASE CLK 61 B99XP 1781 T14339 35322 ?-RAD18 DNA REPAIR 85 38E1T7 1441 T13375 34358 ?-RNA-DIRECTED RNA POLYMERASE 56 34H2T7 1283 T13217 34200 ?-SECRECTION PROTEIN XCPT 62 SCE8T7P 1014 T12948 33931 ?-SEED LIPOXYGENASE-2 58 38E5T7 1448 T13382 34365 ?-SPERM HISTONE 54 36F11T7 1350 T13284 34267 ?-SPORE COAT PROTEIN 53 37C11T7 1391 T13325 34308 ?-SURFACE ANTIGEN 62 12/13/93 MSU Arabidopsis ESTs Page 9 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 43G8T7 2098 T13933 34916 ?-SURFACE LAYER PROTEIN 57 36G1T7 1361 T13295 34278 ?-T-CELL RECEPTOR 60 36C9T7 1334 T13268 34251 ?-TCR-ALPHA GENE 49 37H3T7 1417 T13351 34334 ?-TEMPERATURE-SHOCK INDUCIBLE 61 39E7T7 1499 T13433 34416 ?-TETA 67 B56TP 1713 T14271 35254 ?-THIOSULFATE SULFUR TRANSFERA 70 33g9t7 1241 t13175 34158 ?-THYROTROPH EMBRYONIC FACTOR 77 B88TP 1772 T14330 35313 ?-TRANSCRIPTION FACTOR 60 B94XP 1778 T14336 35319 ?-TRANSMEMBRANE PROTEIN 76 34G9T7 1281 T13215 34198 ?-TROPONIN I 59 39B1T7 1476 T13410 34393 ?-TRYPSIN INHIBIOR IV 58 33H9T7 1243 T13177 34160 ?-TRYPSIN INHIBITOR 64 40B1T7 1545 T13479 34462 ?-TRYPSIN INHIBITOR A1 60 35C10T7 1294 T13228 34211 ?-TRYPSING INHIBITOR 64 50D3T7 1637 T13571 34554 ?-TRYPTOPHAN SYNTHASE BETA 52 38H2T7 1459 T13393 34376 ?-URACIL-DNA GLYCOSYLASE 52 38H2BT7 1457 T13391 34374 ?-URACIL-DNA GLYCOSYLASE 50 40H4T7 1594 T13528 34511 ?-VACUOLAR SORTING PROTEIN 34 62 33H12T7 1242 T13176 34159 ?-VIRULENCE SENSOR PROTEIN 59 34A6T7 1247 T13181 34164 ?-VITELLOGENIN II 63 39C5T7 1485 T13419 34402 ?-ZFPOU 1 PROTEIN 63 40B6T7 1548 T13482 34465 ?-ZINC FINGER PROTEIN 58 34G11T7 1275 T13209 34192 ?PROFILAGGRIN 55 43h12t7 2102 t13937 34920 A-agglutinin AGA1 precursor - 70 46g12t7 2253 t14088 35071 A.marginale surface antigen Am 60 SBD2T7P 939 T12873 33856 ACIDIC PHOSPHOPROTEIN 89 SBD10T7P 935 T12869 33852 ACROSIN PRECURSOR 68 40F11T7 1577 T13511 34494 ACTIN 1 419 33D1T7 1226 T13160 34143 ACTIN DEPOLYMERIZING FACTOR 366 35F12T7 1306 T13240 34223 ACTIN DEPOLYMERIZING FACTOR 272 SBF3T7P 959 T12893 33876 ACYL CARRIER PROTEIN 202 5F12T7P 1648 T13582 34565 ACYL-CO A OXIDASE I PEROXISOMA 116 SCC12T7P 996 T12930 33913 ACYL-COA BINDING PROTEIN 206 35H7T7 1316 T13250 34233 ACYL-COENZYME A OXIDASE I PERO 380 23e1t7 1787 t13622 34605 ADENYLATE CYCLASE TYPE II (ATP 57 4A12T7P 1614 T13548 34531 ADENYLATE TRANSLOCATOR 614 39D7T7 1493 T13427 34410 ADP,ATP CARRIER PROTEIN 391 B86XP 1768 T14326 35309 ADP,ATP CARRIER PROTEIN 235 46b7t7 2224 t14059 35042 ADP,ATP carrier protein - Arab 586 48b2t7 2318 t14153 35136 ADP,ATP carrier protein - Arab 328 42c1t7 2016 t13851 34834 ADP,Atp carrier protein - Arab 546 SBB5T7P 922 T12856 33839 ADP-RIBOSYLATION FACTOR (AT) 649 1G9T7P 1069 T13003 33986 ADP-RIBOSYLATION FACTOR (AT) 338 41c5t7 1966 t13801 34784 ADR11 gene product [Glycine ma 115 B8XP 1777 T14335 35318 ALANINE AMINOTRANSFERASE (GPT) 152 51d7t7 2383 t14218 35201 ALDEHYDE DEHYDROGENASE PRECURS 196 39A6T7 1470 T13404 34387 ALPHA TOXIN 185 12/13/93 MSU Arabidopsis ESTs Page 10 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 31B4T7 1161 T13095 34078 ALPHA-2 TUBULIN 579 39E11T7 1497 T13431 34414 ALPHA-2 TUBULIN 413 B73TP 1748 T14306 35289 ALPHA-GALACTOSIDASE 124 B64TP 1729 T14287 35270 ALPHA-GALACTOSIDASE 108 38A2T7 1421 T13355 34338 ALPHA-GLUCOSIDASE LYSOSOMAL 181 38b9t7 1907 t13742 34725 AMINOMETHYLTRANSFERASE PRECURS 105 SBD3T7P 940 T12874 33857 ANKYRIN OR GA BINDING PROTEIN 103 35H3T7 1315 T13249 34232 ANKYRIN-2 71 32C9T7 1214 T13148 34131 ANNEXIN 225 37F10T7 1411 T13345 34328 ANTHER SPECIFIC PROTEIN SF18 157 38g2t7 1925 t13760 34743 ANTHRANILATE SYNTHASE (CONTAIN 60 33b5t7 1826 t13661 34644 ANTHRANILATE SYNTHASE COMPONEN 55 44c6t7 2129 t13964 34947 ANTIGEN I. >gp|M38210|STRSPAA_ 65 6D2T7P 1654 T13588 34571 APG PROTEIN 77 32F7T7 1223 T13157 34140 APG PROTEIN (AT) 232 20C8T7 1078 T13012 33995 ARSENICAL PUMP DRIVING ATPASE 120 4H8T7P 1632 T13566 34549 ASPARTIC ACID RICH PROTEIN 92 SBC6T7P 932 T12866 33849 ASPARTIC ACID RICH PROTEIN 87 SCE9T7P 1015 T12949 33932 ASPARTIC ACID-RICH PROTEIN PRE 76 36G6T7 1365 T13299 34282 ATAUX2-11 68 35C9T7 1299 T13233 34216 ATHB-2 DNA BINDING PROTEIN 504 39f5t7 1936 t13771 34754 ATP CITRATE-LYASE (CITRATE CLE 81 32A9T7 1201 T13135 34118 ATP SYNTASE GAMMA CHAIN, MITO 131 SBD11T7P 936 T12870 33853 ATP SYNTHASE A CHAIN PROTEIN 6 82 SBE12T7P 946 T12880 33863 ATP SYNTHASE A CHAIN PROTEIN 6 81 60c3t7 2400 t14235 35218 ATP SYNTHASE B CHAIN PRECURSOR 61 B84XP 1764 T14322 35305 ATP SYNTHASE B' CHAIN 147 36E12T7 1343 T13277 34260 ATP SYNTHASE BETA CHAIN, MITO 71 39g1t7 1938 t13773 34756 ATP SYNTHASE BETA CHAIN, MITOC 344 B110XP 1686 T14244 35227 ATP SYNTHASE DELTA 141 46f10t7 2246 t14081 35064 ATP SYNTHASE E CHAIN,MITOCHOND 55 48a12t7 2308 t14143 35126 ATP-binding protein [Escherich 101 45b8t7 2171 t14006 34989 ATP-binding protein [Schizosac 162 36C1T7 1328 T13262 34245 AUX2 PROTEIN 160 B127XP 1694 T14252 35235 AUX28 PROTEIN (SOY BEAN) 147 23c3t7 1103 t13037 34020 Actin - Garden pea | 0.0 0.0 0 501 43b3t7 2056 t13891 34874 Actinidin - Kiwi fruit | 0.0 0 346 42e3t7 2030 t13865 34848 Amino acid permease I - Arabid 103 44h1t7 2159 t13994 34977 Amino acid permease I - Arabid 89 43d4t7 2075 t13910 34893 Annexin - Tomato | 0.0 0.0 0.0 99 44f3t7 2147 t13982 34965 Arabidopsis thaliana gene (LHC 91 47g5t7 2296 t14131 35114 Arabidopsis thaliana tufA gene 544 46c5t7 2229 t14064 35047 Auxin-induced protein (AtAux2- 69 40a10t7 1942 t13777 34760 Auxin-induced protein (clone p 264 44g9t7 2156 t13991 34974 Auxin-induced protein (clone p 216 50c9bt7 2377 t14212 35195 B3-HORDEIN. >gp|X01777|HVB3HOR 60 4D9T7P 1623 T13557 34540 BACTERIOCHLOROPHYLL SYNTHASE 85 12/13/93 MSU Arabidopsis ESTs Page 11 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ B129XP 1696 T14254 35237 BACTERIOFERRITIN COMIG. 94 40C9T7 1559 T13493 34476 BAND 3 RELATED PROTEIN 72 40C11T7 1551 T13485 34468 BETA-GLUCOSIDASE (GENTIOBIASE) 88 40D11T7 1560 T13494 34477 BETA-GLUCOSIDASE GENE 103 34B11T7 1250 T13184 34167 BETA-GLUCOSIDASE NON-CYANOGENI 309 14H3T7 1053 T12987 33970 BETA-HYDROXBUTYRYL COA DH (NAD 213 B64XP 1730 T14288 35271 BETA-TUBULIN (AT) 433 35f3t7 1856 t13691 34674 BRADYKININ RECEPTOR (BK-2 RECE 66 45b12t7 2166 t14001 34984 Barley mRNA for NADPH-protochl 61 46e11t7 2239 t14074 35057 Bovine herpesvirus-4 (clone pH 57 47h7t7 2304 t14139 35122 C-1-TETRAHYDROFOLATE SYNTHASE, 156 35A3T7 1288 T13222 34205 C-7 PROTEIN 439 B85TP 1765 T14323 35306 C-7 PROTEIN (TOB), AUXIN 533 9B6T7P 1679 T13613 34596 C-RAF-1 PROTO-ONCOGENE 80 47d7t7 2280 t14115 35098 C. elegans cosmid C50C3. [Caen 317 23h1t7 1125 t13059 34042 C. elegans cosmid ZK1236. [Cae 72 50a9bt7 2374 t14209 35192 C. elegans cosmid ZK1236. [Cae 64 42d6t7 2026 t13861 34844 C.crescentus hook protein stru 56 S4T7P 900 T12834 33817 CAB 705 SCG1T7P 1028 T12962 33945 CAB 692 SCB12T7P 988 T12922 33905 CAB 614 20C6T7 1077 T13011 33994 CAB 540 SBF7T7P 962 T12896 33879 CAB 527 2D4T7P 1138 T13072 34055 CAB 441 B105XP 1683 T14241 35224 CAB 376 10G8T7P 1040 T12974 33957 CAB 328 SCB2T7P 990 T12924 33907 CAB 262 B73XP 1749 T14307 35290 CAB 217 1F12T7P 1063 T12997 33980 CAB 152 20D3T7 1081 T13015 33998 CAB 143 23B3T7 1095 T13029 34012 CAB 143 23A1T7 1087 T13021 34004 CAB (CP24) 236 23C1T7 1102 T13036 34019 CAB CP24 307 39B3T7 1478 T13412 34395 CAB PHOTOSYSTEM II TYPE I 422 37A1T7 1378 T13312 34295 CAB TYPE I 307 34H12T7 1282 T13216 34199 CAB TYPE III 299 36F2T7 1352 T13286 34269 CAB-10B 325 36B1T7 1323 T13257 34240 CAB-140 550 34G1T7 1276 T13210 34193 CAB-140 546 38A1T7 1420 T13354 34337 CAB-140 427 31D1T7 1173 T13107 34090 CAB-165 553 35G10T7 1309 T13243 34226 CAB-165/180 675 36H7T7 1375 T13309 34292 CAB-165/180 580 33G6T7 1240 T13174 34157 CAB-165/180 566 31F8T7 1183 T13117 34100 CAB-37 553 31G4T7 1187 T13121 34104 CALDESMON, SMOOTH MUSCLE 71 35D10T7 1300 T13234 34217 CAPSID PROTEIN 52 12/13/93 MSU Arabidopsis ESTs Page 12 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 39C3T7 1483 T13417 34400 CARBONIC ANHYDRASE, CHLOROPLAS 412 49f2t7 2364 t14199 35182 CARBONIC ANHYDRASE,CHLOROPLAST 310 39D10T7 1488 T13422 34405 CARBOXYPEPTIDASE Y-LIKE PROTEI 674 32D10T7 1215 T13149 34132 CARBOXYPEPTIDASE Y-LIKE PROTEI 604 5B8T7P 1643 T13577 34560 CARON CATABOLITE DEREPRESS KIN 68 4G4T7P 1629 T13563 34546 CARSR12 PROTEIN 360 20C12T7 1073 T13007 33990 CASEIN KINASE II, ALPHA (CKII) 511 35F2T7 1307 T13241 34224 CATALASE 569 40A1T7 1537 T13471 34454 CATALASE 556 38C1T7 1429 T13363 34346 CATALASE 499 35G12T7 1310 T13244 34227 CATALASE 485 20C1T7 1074 T13008 33991 CATALASE 479 40G3T7 1588 T13522 34505 CATALASE 445 42a6t7 2008 t13843 34826 CATALASE. >pir|S07124|S07124 c 456 34b6t7 1834 t13669 34652 CATALASE. >pir|S18346|CSPM cat 219 23D8T7 1111 T13045 34028 CATHEPSIN E PRECURSOR 110 48a8t7 2315 t14150 35133 CATHEPSIN G PRECURSOR. >pir|A2 53 SBG8T7P 971 T12905 33888 CATHEPSIN S 72 37a11t7 1880 t13715 34698 CATIONIC PEROXIDASE 2 PRECURSO 166 44b9t7 2121 t13956 34939 CDC6 gene product [Saccharomyc 55 45g3t7 2205 t14040 35023 CELL DIVISION CONTROL PROTEIN 354 47f8t7 2293 t14128 35111 CELL DIVISION PROTEIN FTSH. >g 383 36E10T7 1342 T13276 34259 CELL SURFACE ANTIGEN 114/A10 74 B121XP 1691 T14249 35232 CELLULASE 183 38D12T7 1434 T13368 34351 CGMP-GATED CATION CHANNEL PROT 77 34H9T7 1286 T13220 34203 CHALCONE SYNTHASE 662 43c1t7 2065 t13900 34883 CHALCONE SYNTHASE (NARINGENIN- 496 40G1T7 1586 T13520 34503 CHAPERONOIN-LIKE PROTEIN 406 36F6T7 1355 T13289 34272 CHL1 GENE PRODUCT 152 46d11t7 2232 t14067 35050 CHL1 gene product [Arabidopsis 113 34c12t7 1835 t13670 34653 CHLOROPHYLL A-B BINDING PROTEI 541 35g11t7 1859 t13694 34677 CHLOROPHYLL A-B BINDING PROTEI 465 43a7t7 2053 t13888 34871 CHLOROPHYLL A-B BINDING PROTEI 459 41b10t7 1958 t13793 34776 CHLOROPHYLL A-B BINDING PROTEI 428 32f4t7 1812 t13647 34630 CHLOROPHYLL A-B BINDING PROTEI 344 47h3t7 2300 t14135 35118 CHLOROPHYLL A-B BINDING PROTEI 317 35a7t7 1844 t13679 34662 CHLOROPHYLL A-B BINDING PROTEI 300 49a9t7 2350 t14185 35168 CHLOROPHYLL A-B BINDING PROTEI 88 20f5t7 1083 t13017 34000 CHLOROPLAST PHOSPHATE TRANSLOC 498 34C5T7 1258 T13192 34175 CHLOROPLAST PHOSPHATE TRANSLOC 448 40F9T7 1585 T13519 34502 CHLOROPLAST PHOSPHATE TRANSLOC 326 43h2t7 2104 t13939 34922 CHLOROPLAST PHOSPHATE TRANSLOC 67 32F8T7 1224 T13158 34141 CHLOROPLAST RIBOSOMAL L12(AT) 453 33F2T7 1233 T13167 34150 CHLOROPLAST RIBOSOMAL L12-1 P 164 35C2T7 1297 T13231 34214 CHROMAFFIN GRANULE AMINE TRANS 66 SCD12T7P 1003 T12937 33920 CINNAMATE 4-HYDROXYLASE 380 32e11t7 1220 t13154 34137 CINNAMYL-ALCOHOL DEHYDROGENASE 395 12/13/93 MSU Arabidopsis ESTs Page 13 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 33E10T7 1230 T13164 34147 CINNAMYL-ALCOHOL DEHYDROGENASE 395 6E9T7P 1661 T13595 34578 COLLAGEN-RELATED PROTEIN 2 101 49g11t7 2370 t14205 35188 CONOPRESSIN PRECURSOR. >gp|M86 51 40C7T7 1557 T13491 34474 COR47 PROTEIN 472 34A9T7 1249 T13183 34166 COR47 PROTEIN 101 B58XP 1718 T14276 35259 COR47 PROTEIN (AT) 151 B58TP 1717 T14275 35258 COR47 PROTEIN (AT);RAB 16C 75 45g10t7 2202 t14037 35020 CP29 [Arabidopsis thaliana] 302 45e2t7 2193 t14028 35011 CP29 [Arabidopsis thaliana] 199 SBG3T7P 969 T12903 33886 CRUCIFERIN 254 B69XP 1740 T14298 35281 CYC 7 PROTEIN S-PHASE 130 31H2T7 1192 T13126 34109 CYCLIC NUCLEOTIDE-GATED CHANNE 94 42F12T7 1607 T13541 34524 CYSTATIN I 257 41A2T7 1598 T13532 34515 CYSTEINE PROTEINASE PRECURSOR 280 43d1t7 2073 t13908 34891 CYSTEINE SYNTHASE A (O-ACETYLS 472 40F12T7 1578 T13512 34495 CYSTEINYL-TRNA SYNTHETASE 150 4E7T7P 1625 T13559 34542 CYTIDINE DEAMINASE 76 40E11T7 1568 T13502 34485 CYTOCHROM P450 LXXIA1 (ARP-2) 114 5E1T7P 1645 T13579 34562 CYTOCHROME B561 158 39G11T7 1508 T13442 34425 CYTOCHROME B6-F COMPLEX RIESKE 104 20C2T7 1075 T13009 33992 CYTOCHROME P-450 (CATHARANTHU 190 5G6T7P 1652 T13586 34569 CYTOCHROME P-450 LXXIA1 240 B72TP 1746 T14304 35287 CYTOCHROME P450 212 B71TP 1743 T14301 35284 CYTOCHROME P450 209 B71XP 1744 T14302 35285 CYTOCHROME P450 64 B72XP 1747 T14305 35288 CYTOCHROME P450 62 2G8T7P 1147 T13081 34064 CYTOCHROME P450 (AVACADO) 87 5G6XP 1653 T13587 34570 CYTOCHROME P450 LXXIA1 187 47d12t7 2277 t14112 35095 CYTOCHROME P450 LXXIA1 (ARP-2) 224 50b7bt7 2376 t14211 35194 CYTOCHROME P450 LXXIA1 (ARP-2) 105 2G8XP 1148 T13082 34065 CYTOCHROME P450 LXXIAI 141 40h2t7 1953 t13788 34771 CYTOSKELETON-LIKE BICAUDAL D P 66 SBB7T7P 923 T12857 33840 CYTOSOL AMINOPEPTIDASE (AT) 160 41d8t7 1977 t13812 34795 Carassius auratus gene,complet 92 41a4t7 1956 t13791 34774 Carboxypeptidase B (E.C.3.4.12 59 15f3t7 1056 t12990 33973 Catalase - Soybean #EC-number 293 43b4t7 2057 t13892 34875 Catalase - Upland cotton #EC-n 454 46f8t7 2251 t14086 35069 Catalase [Vigna radiata] 480 15d5t7 1055 t12989 33972 Catalase [Vigna radiata] 476 41d4t7 1975 t13810 34793 Chicken vitellogenin gene codi 58 41c11t7 1964 t13799 34782 Chlorophyll a/b-binding protei 421 40a11t7 1943 t13778 34761 Cor47 protein - Arabidopsis th 384 43g6t7 2096 t13931 34914 Cysteine proteinase inhibitor 189 36d3t7 1876 t13711 34694 Cysteine proteinase precursor 251 47f1t7 2291 t14126 35109 D-3-PHOSPHOGLYCERATE DEHYDROGE 75 42d1t7 2024 t13859 34842 DASH/ABL PROTO-ONCOGENE TYROSI 62 SBB10T7P 916 T12850 33833 DIAMINOPIMELATE EPIMERASE 180 12/13/93 MSU Arabidopsis ESTs Page 14 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ SBE3T7P 948 T12882 33865 DIN1 GENE 360 41g9t7 2002 t13837 34820 DNA TERMINAL PROTEIN (BELLETT 70 49f7t7 2367 t14202 35185 DNA TOPOISOMERASE II. >pir|S02 70 47h5t7 2302 t14137 35120 DNA-REPAIR PROTEIN COMPLEMENTI 55 43h11t7 2101 t13936 34919 DNA-binding protein (clone XLc 60 23f2t7 1790 t13625 34608 DNAJ PROTEIN. >gp|M74569|CLOGR 129 34C6T7 1259 T13193 34176 DYNAMIN-1 328 43e7t7 2083 t13918 34901 Daucus carota 1.2 mRNA [Daucus 144 42e8t7 2033 t13868 34851 Drosophila mRNA for laminin B2 54 42G11T7 1609 T13543 34526 E. COLI FHUB GENE 89 51f5t7 2386 t14221 35204 E. coli chromosomal region fro 60 31G11T7 1184 T13118 34101 EBNA-2 NUCLEAR PROTEIN 67 46d10t7 2231 t14066 35049 EBNA-2 NUCLEAR PROTEIN. 75 37g3t7 1892 t13727 34710 ECA39 PROTEIN. >pir|S13108|S13 60 46b10t7 2219 t14054 35037 ECDYSONE-INDUCIBLE PROTEIN E75 60 42h6t7 2046 t13881 34864 EDGP precursor [Daucus carota] 94 46e10t7 2238 t14073 35056 EGG-LYSIN PRECURSOR (SPERM-LYS 61 23B7T7 1098 T13032 34015 EIF 4A-1 401 40E9T7 1575 T13509 34492 ELIP STEM II PSII 101 40D3T7 1562 T13496 34479 ELONGATION FACTOR 1 ALPHA-4A 468 34F7T7 1273 T13207 34190 ELONGATION FACTOR 1 BETA' 308 45e12t7 2191 t14026 35009 ELONGATION FACTOR 1 BETA'. >pi 146 39D9T7 1495 T13429 34412 ELONGATION FACTOR 1-GAMMA 146 37b11t7 1384 t13318 34301 ELONGATION FACTOR 1-GAMMA (EF- 146 37C1T7 1393 T13327 34310 ELONGATION FACTOR 2 (EF-2) 485 38f4t7 1922 t13757 34740 ELONGATION FACTOR 2 (EF-2). >p 66 35E10T7 1302 T13236 34219 ELONGATION FACTOR 3 (EF-3) 94 34F5T7 1272 T13206 34189 ELONGATION FACTOR TU 468 35E2T7 1303 T13237 34220 ELONGATION FACTOR TU (EF-TU) 447 36A2T7 1320 T13254 34237 ELONGATION FACTOR TU CHLOROPLA 573 23f1t7 1789 t13624 34607 ELONGATION FACTOR TU CHLOROPLA 473 45f5t7 2199 t14034 35017 ELONGATION FACTOR TU,CHLOROPLA 442 46d6t7 2235 t14070 35053 ELONGATION FACTOR TU,CHLOROPLA 385 23B9T7 1099 T13033 34016 ENDOGLUCANASE F PRECURSOR 142 46c4t7 2228 t14063 35046 ENOD8 gene product [Medicago s 96 45b5t7 2168 t14003 34986 ENOD8 gene product [Medicago s 67 38e12t7 1917 t13752 34735 ENOLASE (2-PHOSPHOGLYCERATE DE 360 SBE4T7P 949 T12883 33866 ENVELOPE GLYCOPROTEIN 69 43e8t7 2084 t13919 34902 ENVELOPE POLYPROTEIN GP160 PRE 64 33B2T7 1225 T13159 34142 EPOXIDE HYDROLASE-CYTOPLASMIC 265 31B3T7 1160 T13094 34077 ETHYLENE FORMING ENZYME 196 40F10T7 1576 T13510 34493 ETHYLENE-RESPONSIVE FRUIT RIPE 293 2A6T7P 1128 T13062 34045 ETHYLENE-RESPONSIVE FRUIT RIPE 122 41d3t7 1974 t13809 34792 EUKARYOTIC INITIATION FACTOR 4 69 39C1T7 1482 T13416 34399 EUKARYOTIC INTIATION FACTOR 4B 76 48d8t7 2333 t14168 35151 EXFOLIATIVE TOXIN B PRECURSOR 55 SBF11T7P 955 T12889 33872 EXTENSIN 73 12/13/93 MSU Arabidopsis ESTs Page 15 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 1C4T7P 1060 T12994 33977 EXTENSIN 71 34H4T7 1284 T13218 34201 EXTENSIN 66 35F8T7 1308 T13242 34225 EXTENSIN (CELL WALL HYDROXYPRO 86 SCA11T7P 981 T12915 33898 EXTENSIN (CLASS I) 123 49b1t7 2351 t14186 35169 EXTENSIN PRECURSOR (CELL WALL 65 36A12T7 1319 T13253 34236 EXTENSIN PROLINE-RICH PROTEIN 79 43h10t7 2100 t13935 34918 Extensin - Potato | 0.0 0.0 0. 60 47a10t7 2263 t14098 35081 Extensin-like protein - Persia 68 41g10t7 1997 t13832 34815 F-ACTIN CAPPING PROTEIN BETA S 64 41d12t7 1972 t13807 34790 FATTY ACID DESATURASE. >pir|S1 274 49h8t7 2372 t14207 35190 FERREDOXIN PRECURSOR. >pir|S09 502 44a3t7 2113 t13948 34931 FERREDOXIN PRECURSOR. >pir|S09 354 36B4T7 1326 T13260 34243 FERRIPYOCHELIN BINDING PROTEIN 143 39F7T7 1504 T13438 34421 FERRITIN PRECURSOR 230 32g3t7 1816 t13651 34634 FIBRONECTIN-BINDING PROTEIN PR 97 39A12T7 1467 T13401 34384 FRUCTOSE-BISPHOSPHATE ALDOLASE 489 36C5T7 1331 T13265 34248 FRUCTOSE-BISPHOSPHATE ALDOLASE 321 14d10t7 1051 t12985 33968 FRUCTOSE-BISPHOSPHATE ALDOLASE 319 38d11t7 1913 t13748 34731 FRUCTOSE-BISPHOSPHATE ALDOLASE 282 31C3T7 1167 T13101 34084 FRUCTOSE-BISPHOSPHATE ALDOLASE 192 46g7t7 2256 t14091 35074 FRUCTOSE-BISPHOSPHATE ALDOLASE 129 46f1t7 2248 t14083 35066 Feline leukemia virus,subgroup 64 23f3t7 1791 t13626 34609 Flavonol 4-sulfotransferase- F 137 41f5t7 1992 t13827 34810 Fructose-1,6-bisphosphate [Bra 59 S12T7P 888 T12822 33805 G3P DEHYDROGENASE 494 B66TP 1735 T14293 35276 G3P DEHYDROGENASE 380 B59TP 1719 T14277 35260 G3P DEHYDROGENASE 209 B59XP 1720 T14278 35261 G3P DEHYDROGENASE (AT) 631 B66XP 1736 T14294 35277 G3P DEHYDROGENASE (AT) 380 35C12T7 1296 T13230 34213 GAA FOR LYSOSOMAL A-GLUCOSIDAS 87 43c9t7 2071 t13906 34889 GDP-MANNOSE 6-DEHYDROGENASE (G 61 60c6t7 2402 t14237 35220 GENE 15 MEMBRANE PROTEIN. >pir 58 33e5t7 1830 t13665 34648 GENOME POLYPROTEIN (CONTAINS: 53 45e10t7 2189 t14024 35007 GENOME POLYPROTEIN. >gp|M96751 58 42G9T7 1610 T13544 34527 GERANYLGERANLY PPI SYNTHETASE 107 SCB11T7P 987 T12921 33904 GF14 (AT) PROTEIN KINASE 408 SCF2T7P 1020 T12954 33937 GF14 (PROTEIN KINASE) (AT) 251 38H8T7 1464 T13398 34381 GF14 PROTEIN CHI CHAIN 253 38b7t7 1905 t13740 34723 GF14 gene product [Arabidopsis 557 36b5t7 1869 t13704 34687 GF14 gene product [Arabidopsis 202 45d3t7 2184 t14019 35002 GIANT SECRETORY PROTEIN I-B (G 72 47f7t7 2292 t14127 35110 GLUCOSAMINE--FRUCTOSE-6-PHOSPH 57 8B8T7P 1670 T13604 34587 GLUCOSE TRANSPORT PROTEIN 122 33b12t7 1823 t13658 34641 GLUCOSE TRANSPORT PROTEIN. >pi 66 51g3t7 2389 t14224 35207 GLUCOSE TRANSPORTER (SUGAR CAR 55 46e3t7 2242 t14077 35060 GLUCOSE TRANSPORTER PROTEIN,LI 62 38E3T7 1443 T13377 34360 GLUCOSE-1-P ADENYLTRANSFERASE 300 12/13/93 MSU Arabidopsis ESTs Page 16 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 35d3t7 1848 t13683 34666 GLUCOSE-6-PHOSPHATE 1-DEHYDROG 270 42H10T7 1611 T13545 34528 GLUCOSE-6-PHOSPHATE DEHYDROGEN 129 37B9T7 1390 T13324 34307 GLUTAMATE AMMONIA LIGASE 389 5B2T7P 1642 T13576 34559 GLUTAMATE DECARBOXYLASE 227 35B3T7 1291 T13225 34208 GLUTAMATE DECARBOXYLASE 221 37D11T7 1399 T13333 34316 GLUTAMATE SYNTHASE, FERRIDOXIN 420 31H5T7 1194 T13128 34111 GLUTAMATE-AMMONIA LIGASE 443 SBD1T7P 938 T12872 33855 GLUTAMIC ACID RICH PROTEIN 219 36G5T7 1364 T13298 34281 GLUTAMIC ACID RICH PROTEIN 78 B75TP 1752 T14310 35293 GLUTAMIC ACID RICH PROTEIN 53 40B11T7 1543 T13477 34460 GLUTAMIC ACID-RICH PROTEIN 86 31H1T7 1191 T13125 34108 GLUTAMIC ACID-RICH PROTEIN 77 45c1t7 2175 t14010 34993 GLUTAMIC ACID-RICH PROTEIN. >g 98 32A3T7 1199 T13133 34116 GLUTAMINE SYNTHETASE 446 46c3t7 2227 t14062 35045 GLUTAMINE SYNTHETASE (GLUTAMAT 345 23C7T7 1105 T13039 34022 GLUTAMINE-AMMONIA LIGASE 469 23c12t7 1101 t13035 34018 GLUTAMINE-AMMONIA LIGASE 469 B67XP 1738 T14296 35279 GLUTAMINE-AMMONIA LIGASE (AT) 492 39E9T7 1501 T13435 34418 GLUTATHIONE S-TRANSFERASE 394 32e1t7 1804 t13639 34622 GLYCERALDEHYDE 3-PHOSPHATE DEH 521 34c2t7 1836 t13671 34654 GLYCERALDEHYDE 3-PHOSPHATE DEH 474 48b1t7 2317 t14152 35135 GLYCERALDEHYDE 3-PHOSPHATE DEH 449 36E4T7 1346 T13280 34263 GLYCERALDEHYDE 3-PHOSPHATE DH 628 32D9T7 1219 T13153 34136 GLYCERALDEHYDE 3-PHOSPHATE DH 541 5A8T7P 1640 T13574 34557 GLYCERALDEHYDE-3-P DH 190 44h12t7 2158 t13993 34976 GLYCINE DEHYDROGENASE (DECARBO 48 S35ATM 897 T12831 33814 GLYCINE RICH CELL WALL PROTEIN 85 39H11T7 1512 T13446 34429 GLYCINE RICH PROTEIN 449 B55TP 1711 T14269 35252 GLYCINE RICH PROTEIN 187 SBG2T7P 968 T12902 33885 GLYCINE RICH PROTEIN (AT) 199 40H5T7 1595 T13529 34512 GLYCINE RICH PROTEIN RNA BINDI 291 44g1t7 2151 t13986 34969 GLYCINE-RICH CELL WALL STRUCTU 96 34A8T7 1248 T13182 34165 GLYCINE-RICH CELL WALL-GRP 1.8 128 35C11T7 1295 T13229 34212 GLYCINE-RICH PROTEIN 2 473 33b10t7 1822 t13657 34640 GLYCOGEN (STARCH) SYNTHASE LIV 61 B61XP 1724 T14282 35265 GLYCOPROTEIN X PRECURSOR 62 45b10t7 2164 t13999 34982 GLYCOPROTEIN X PRECURSOR. >pir 76 23g6t7 1796 t13631 34614 GLYCOPROTEIN X PRECURSOR. >pir 75 2A8T7P 1129 T13063 34046 GOS2 PROTEIN (RICE) 101 32B11T7 1203 T13137 34120 GRANATICIN POLYKETIDE SYNTHASE 126 23a3t7 1783 t13618 34601 GRANULE MEMBRANE PROTEIN 140 P 54 45f6t7 2200 t14035 35018 GRP94 homolog - Barley | 0.0 0 275 SCH1T7P 1036 T12970 33953 GTP CYCLOHYDROLASE II 258 31B2T7 1159 T13093 34076 GTP-BINDING PROTEIN 640 8E6T7P 1673 T13607 34590 GTP-BINDING PROTEIN ARA-3 432 44d8t7 2136 t13971 34954 GTP-binding protein - Arabidop 230 48a10t7 2307 t14142 35125 GTP-binding protein GSP2 - yea 243 12/13/93 MSU Arabidopsis ESTs Page 17 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 47a12t7 2265 t14100 35083 GTP-binding protein [Pisum sat 201 35g7t7 1861 t13696 34679 GUANINE NUCLEOTIDE-BINDING PRO 285 41d5t7 1976 t13811 34794 Gene A6 protein - Arabidopsis 98 41e2t7 1982 t13817 34800 Gene C-7 protein - Common toba 390 50d3bt7 2378 t14213 35196 Gene ERCC3 protein - Fruit fly 57 23b11t7 1093 t13027 34010 Glutamate--ammonia ligase - Ar 661 48g3t7 2343 t14178 35161 Glutathione S-transferase III 197 35d5t7 1850 t13685 34668 Glyceraldehyde 3-phosphate deh 310 42f4t7 2036 t13871 34854 Glycine-rich RNA-binding prote 353 38a9t7 1902 t13737 34720 Glycine-rich RNA-binding prote 220 45c5t7 2178 t14013 34996 Group 4 late embryogenesis-abu 121 37b12t7 1385 t13319 34302 H(+)-transporting ATPase [Mand 204 40F1T7 1579 T13513 34496 H+-TRANSPORTING ATP SYNTHASE B 641 47e11t7 2282 t14117 35100 H.sapiens GAA mRNA for lysosom 87 42c6t7 2018 t13853 34836 H2B histone - Maize | 0.0 0.0 125 B54TP 1710 T14268 35251 HEAT SHOCK 70KD 235 38E4T7 1446 T13380 34363 HEAT SHOCK COGNATE 70 KD 427 B87TP 1769 T14327 35310 HEAT SHOCK COGNATE 70 KD 218 38E4XP 1447 T13381 34364 HEAT SHOCK COGNATE 70 KD 135 42f9t7 2038 t13873 34856 HEAT SHOCK COGNATE 70 KD PROTE 403 46c8t7 2230 t14065 35048 HEAT SHOCK COGNATE 70 KD PROTE 389 2a9t7p 1130 t13064 34047 HELICASE 85 2H1T7P 1149 T13083 34066 HEMOGLOBINASE PRECURSOR 200 41h2t7 2003 t13838 34821 HEVEIN PRECURSOR. >pir|A38288| 276 34g10t7 1841 t13676 34659 HFLK PROTEIN. >pir|B43653|B436 63 5F9T7P 1650 T13584 34567 HISTIDINE RICH GLYCOPROTEIN 214 35D8T7 1301 T13235 34218 HISTIDINE RICH PROTEIN 83 47a9t7 2266 t14101 35084 HISTONE H2A VARIANT. >pir|S032 201 6H7T7P 1664 T13598 34581 HISTONE H2A-IV 270 SCF9T7P 1024 T12958 33941 HISTONE H2B.2 215 33G1T7 1237 T13171 34154 HISTONE H3.3 LIKE 514 38B6T7 1428 T13362 34345 HOMEOBOX PROTEIN 166 48e3t7 2337 t14172 35155 HOMEOTIC GENE REGULATOR (BRAHM 76 3A4T7P 1523 T13457 34440 HSP70 483 SBB8 924 t12858 33841 HUMAN SCAR PROTEIN 234 37F12T7 1412 T13346 34329 HXK2 GENE 76 35A11T7 1287 T13221 34204 HYDROGENASE SOLUBLE 42KD SUBUN 83 35B1T7 1290 T13224 34207 HYDROXYLASE 83 31C2T7 1166 T13100 34083 HYPOTHETICAL (PIR::S11850) 163 47g11t7 2295 t14130 35113 HYPOTHETICAL 15.5 KD PROTEIN I 54 SBH7T7P 979 T12913 33896 HYPOTHETICAL 16.5 K PROTEIN 130 46g4t7 2254 t14089 35072 HYPOTHETICAL 20.0 KD PROTEIN I 101 42e10t7 2028 t13863 34846 HYPOTHETICAL 26.3 KD PROTEIN I 59 35d12t7 1847 t13682 34665 HYPOTHETICAL 28.6 KD PROTEIN ( 59 48d3t7 2331 t14166 35149 HYPOTHETICAL 35.2 KD PROTEIN I 51 40g5t7 1951 t13786 34769 HYPOTHETICAL 45.0 KD PROTEIN I 78 42h4t7 2045 t13880 34863 HYPOTHETICAL 69.3 KD PROTEIN I 64 12/13/93 MSU Arabidopsis ESTs Page 18 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 48e10t7 2334 t14169 35152 HYPOTHETICAL 72.7 KD PROTEIN I 58 42c12t7 2015 t13850 34833 HYPOTHETICAL GUANINE NUCLEOTID 113 31G2T7 1185 T13119 34102 HYPOTHETICAL PROT (PIR::S16273 585 35B10T7 1289 T13223 34206 HYPOTHETICAL PROTEIN 341 39B7T7 1479 T13413 34396 HYPOTHETICAL PROTEIN 325 6E7T7P 1660 T13594 34577 HYPOTHETICAL PROTEIN 160 39C9T7 1487 T13421 34404 HYPOTHETICAL PROTEIN 1 349 31A3T7 1153 T13087 34070 HYPOTHETICAL PROTEIN F-327 74 31B5T7 1162 T13096 34079 HYPOTHETICAL PROTEIN RO8D7 223 40F4T7 1581 T13515 34498 HYPOTHETICAL PROTLINE-RICH PRO 105 47f12t7 2290 t14125 35108 Heat shock cognate 70K protein 251 44c11t7 2123 t13958 34941 Histone H3.3-like protein - Ar 487 43g5t7 2095 t13930 34913 Histone H3.3-like protein - Ar 368 42b7t7 2012 t13847 34830 Homeotic protein EVX2 - human 57 49b7t7 2353 t14188 35171 Homeotic protein msh - Chloroh 59 34d5t7 1838 t13673 34656 Homo sapiens 59 protein mRNA, 67 49a7t7 2349 t14184 35167 Human U1 small nuclear ribonuc 67 47f10t7 2288 t14123 35106 Human gene for catalase (EC 1. 54 43c3t7 2066 t13901 34884 Human papillomavirus type 4 co 54 46g9t7 2257 t14092 35075 Hydroxyproline-rich glycoprote 65 32e3t7 1806 t13641 34624 Hypothetical protein - Escheri 87 47h4t7 2301 t14136 35119 Hypothetical protein - Garden 155 23e12t7 1114 t13048 34031 Hypothetical protein - Garden 141 41a9t7 1957 t13792 34775 Hypothetical protein - Golden 65 46b9t7 2225 t14060 35043 Hypothetical protein - Human h 61 38c5t7 1910 t13745 34728 Hypothetical protein 1 (insert 53 37b7t7 1882 t13717 34700 Hypothetical protein 1 - Arabi 342 46h12t7 2258 t14093 35076 Hypothetical protein B0464.2 - 64 46a4t7 2214 t14049 35032 Hypothetical protein BVRF1 - s 55 35H11T7 1313 T13247 34230 IG ALPHA CHAIN C REGION 72 36H10T7 1369 T13303 34286 IMMEDIATE-EARLY PROTEIN 100 36H4T7 1373 T13307 34290 IMMEDIATE-EARLY PROTEIN 70 40C4T7 1554 T13488 34471 INHIBIN BETA-B CHAIN 70 B48TP 1706 T14264 35247 INITIATION FACTOR 4A 597 37e6t7 1888 t13723 34706 INITIATION FACTOR 5A (EIF-5A) 457 48c9t7 2329 t14164 35147 INITIATION FACTOR 5A (EIF-5A) 83 42d12t7 2023 t13858 34841 INSULIN-LIKE RECEPTOR. >pir|A2 72 5E4T7P 1646 T13580 34563 INT [STRPTOMYCES] 82 1G2T7P 1066 T13000 33983 ISOPENTENYL-DIPHOSPHATE ISOMER 126 23c6t7 1104 t13038 34021 Inositol-1,4,5-trisphosphate 5 125 45h9t7 2212 t14047 35030 Int [Streptomyces coelicolor] 55 39G7T7 1510 T13444 34427 KDEL RECEPTOR 221 39E8T7 1500 T13434 34417 KERATIN 1 57 41b1t7 1960 t13795 34778 KERATIN, TYPE II CYTOSKELETAL 177 20C11T7 1072 T13006 33989 KINASE 113 34H8T7 1285 T13219 34202 KINESIN LIGH CHAIN ISOFORM 4 89 38A4T7 1422 T13356 34339 KROX-24 DEVELOPMENTAL CONTROL 24 12/13/93 MSU Arabidopsis ESTs Page 19 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ SCD9T7P 1007 T12941 33924 L-ASCORBATE PEROXIDASE 789 SCD11T7P 1002 T12936 33919 L-ASCORBATE PEROXIDASE 633 45a7t7 2163 t13998 34981 L-ascorbate peroxidase precurs 202 46h8t7 2261 t14096 35079 L1 gene product [Arabidopsis t 290 47c11t7 2274 t14109 35092 LACCASE PRECURSOR (BENZENEDIOL 57 4C8T7P 1621 T13555 34538 LACTASE-PHLORIZIN HYDROLASE 100 35G1T7 1311 T13245 34228 LACTOYL GLUTATHIONE LYASE 85 SCE2T7P 1012 T12946 33929 LAMININ RECEPTOR (DROSOPHILA) 487 32g12t7 1815 t13650 34633 LARGE STRUCTURAL PHOSPHOPROTEI 60 32e4t7 1807 t13642 34625 LEGUMIN TYPE B PRECURSOR. >gp| 90 36D10T7 1335 T13269 34252 LIN-11 PROTEIN 88 B62TP 1725 T14283 35266 LINAMARASE 157 B62XP 1726 T14284 35267 LINAMARASE 107 36C4T7 1330 T13264 34247 LINOLEIC ACID DESATURASE 150 3F12T7P 1530 T13464 34447 LIPASE PRECURSOR 90 45b11t7 2165 t14000 34983 Laminin receptor homolog - Ara 415 45c2t7 2176 t14011 34994 Laminin receptor homolog - Ara 281 44c12t7 2124 t13959 34942 Lectin LEC1 - Barrel medic | 0 102 36c7t7 1874 t13709 34692 Lhcb5 protein - Scotch pine | 215 46d4t7 2234 t14069 35052 Long-chain-fatty-acid--CoA lig 63 45d2t7 2183 t14018 35001 MAJOR DNA-BINDING PROTEIN (MDB 61 42A5T7 1605 T13539 34522 MAJOR LATEX PROTEIN 89 34E4T7 1268 T13202 34185 MAJOR SECRETED PROTEIN MPB70 80 48b8t7 2320 t14155 35138 MAJOR TAIL SHEATH PROTEIN (PRO 63 8C5T7P 1672 T13606 34589 MALATE DEHYDROGENASE (NADP) 293 B46TP 1704 T14262 35245 MALATE DEHYDROGENASE CYTOPLASM 111 37h4t7 1898 t13733 34716 MALATE DEHYDROGENASE, GLYOXYSO 171 34F10T7 1270 T13204 34187 MALATE SYNTHASE, GLYOXYSOMAL 272 36F8T7 1357 T13291 34274 MALIC ENZYME 544 37E4T7 1407 T13341 34324 MALIC ENZYME NADP+ DEPENDENT 127 48f11t7 2340 t14175 35158 MAP kinase [Medicago sativa] > 88 48h1t7 2346 t14181 35164 MAP kinase homologue [Pisum sa 220 39C12T7 1481 T13415 34398 MATERNAL TUDOR PROTEIN 68 23e6t7 1788 t13623 34606 MDA receptor subtype 2C [Rattu 58 41G5T7 1601 T13535 34518 MECP-2 GENE PRODUCT 69 40B12T7 1544 T13478 34461 MEI2 PROTEIN 285 31E2T7 1178 T13112 34095 MEMBRANE ASSOC. ATPASE GAMMA 67 SBF1T7P 957 T12891 33874 MEMBRANE CHANNEL ROOT SPECIFIC 640 4A9T7P 1615 T13549 34532 MERI-5 (AT) 349 41f9t7 1996 t13831 34814 METALLOTHIONEIN I HOMOLOG. >pi 172 35b2t7 1845 t13680 34663 METALLOTHIONEIN I HOMOLOG. >pi 162 60c4t7 2401 t14236 35219 METAPYROCATECHASE 1 (CATO2ASE) 55 38H1T7 1456 T13390 34373 METHIONINE SYNTHASE DELTA-P8 189 33F1T7 1232 T13166 34149 METHYLAMINE OXIDASE 291 42d10t7 2022 t13857 34840 MHC BKN104 gene product [Bos i 62 47b10t7 2267 t14102 35085 MHC class III histocompatibili 59 41g8t7 2001 t13836 34819 MINOR CORE PROTEIN LAMBDA 3. > 63 12/13/93 MSU Arabidopsis ESTs Page 20 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 41e11t7 1980 t13815 34798 MIPP protein - Mouse | 0.0 0.0 63 45g8t7 2208 t14043 35026 MITOCHONDRIAL 2-OXOGLUTARATE/M 112 23c10t7 1784 t13619 34602 MITOCHONDRIAL BROWN FAT UNCOUP 88 23F12T7 1119 T13053 34036 MITOCHONDRIAL COMPLEX I 23K 321 43g12t7 2091 t13926 34909 MOV34 PROTEIN. >pir|A40556|BWM 352 48g12t7 2342 t14177 35160 MSE55=55 kda serum constituent 65 S1T7P 892 T12826 33809 MUCIN 77 40F2T7 1580 T13514 34497 MUCIN 76 39B12T7 1475 T13409 34392 MULTIDRUG RESISTANCE-ASSOCIATE 230 8E9T7P 1674 T13608 34591 MULTIPLE ANTIBIOTIC RESISTANCE 153 1B4T7P 1059 T12993 33976 MYB PROTEIN 308 471 36F12T7 1351 T13285 34268 MYOSIN 72 45h7t7 2210 t14045 35028 MYOSIN II (MYOSIN-LIKE HEAVY C 53 34B7T7 1254 T13188 34171 MYROSINASE 161 42h2t7 2044 t13879 34862 MYROSINASE PRECURSOR (SINIGRIN 233 48e1t7 2336 t14171 35154 Major latex protein (clone gML 79 43c11t7 2063 t13898 34881 Mouse MHC H-2K/t-w5-linked ope 86 44b7t7 2120 t13955 34938 Mouse putative primordial prot 66 44b1t7 2118 t13953 34936 Murine gene for U1RNA-associat 55 46h6t7 2260 t14095 35078 Mycobacteriophage L5 complete 59 37h12t7 1897 t13732 34715 N-type calcium channel alpha-1 57 46h3t7 2259 t14094 35077 N-type calcium channel alpha-1 56 38D9T7 1438 T13372 34355 NADH DEHYDORGENASE CHAIN PSST 448 SBA2T7P 909 T12843 33826 NADH DH SUBUNIT 5 56 23a11t7 1085 t13019 34002 NADH-PLASTOQUINONE OXIDOREDUCT 60 38C2T7 1430 T13364 34347 NADH-UBIQUINONE OXIDOREDUCTASE 141 38c8t7 1912 t13747 34730 NADH-UBIQUINONE OXIDOREDUCTASE 141 11E10T7P 1050 T12984 33967 NADH-UBIQUINONE OXIDOREDUCTASE 106 23h3t7 1126 t13060 34043 NADH-UBIQUINONE OXIDOREDUCTASE 56 46a9t7 2218 t14053 35036 NADH-ubiquinone oxidoreductase 159 31G6T7 1188 T13122 34105 NADPH DEHYDORGENASE 133 46d9t7 2237 t14072 35055 NADPH-specific isocitrate dehy 482 32f11t7 1809 t13644 34627 NAPHTHALENE 1,2-DIOXYGENASE AL 56 31F5T7 1182 T13116 34099 NAPRP3 71 14H6T7 1054 T12988 33971 NECULEOLIN PROTEIN (23) 83 36C10T7 1871 T13706 34689 NEUROFILAMENT PROTEIN 62 45d8t7 2187 t14022 35005 NEUROFILAMENT TRIPLET M PROTEI 62 34b3t7 1833 t13668 34651 NEUROTOXIN ESTX, 4.3 KD. >pir| 58 47e8t7 2287 t14122 35105 NEUROTOXIN ESTX,4.3 KD. >pir|S 55 3H7T7P 1534 T13468 34451 NIFU PROTEIN 73 51e11t7 2384 t14219 35202 NODULATION PROTEIN D II. >pir| 59 1A3T7P 1057 T12991 33974 NODULIN-26 256 40E1T7 1569 T13503 34486 NODULIN-26 HOMOLOG 508 7F4T7P 1666 T13600 34583 NODULIN-26 HOMOLOG 194 23c4t7 1786 t13621 34604 NONE 32h6t7 1818 t13653 34636 NONE 35E7T7 1304 T13238 34221 NONE 12/13/93 MSU Arabidopsis ESTs Page 21 All clones are at the ABRC: arabidopsis+@msu.edu Clone-Id EST-Id Genbank NCBI-Id BLASTX BLASTX Access # Homolog Score -------- ------ ------- ------- ------------------------------ ------ 35e9t7 1855 t13690 34673 NONE 36c12t7 1872 t13707 34690 NONE 36h3t7 1372 t13306 34289 NONE 38a10t7 1901 t13736 34719 NONE 39e2t7 1931 t13766 34749 NONE 43d5t7 2076 t13911 34894 NONE 43e1t7 2081 t13916 34899 NONE 43h9t7 2109 t13944 34927 NONE 44f7t7 2148 t13983 34966 NONE 44h11t7 2157 t13992 34975 NONE 46g6t7 2255 t14090 35073 NONE 46h9t7 2262 t14097 35080 NONE 47b12t7 2269 t14104 35087 NONE 47h8t7 2305 t14140 35123 NONE 48e5t7 2338 t14173 35156 NONE SBH6T7P 978 T12912 33895 NONSPECIFIC LIPID TRANSFER PRO 229 44e12t7 2137 t13972 34955 NONSTRUCTURAL POLYPROTEIN (CON 57 36a9t7 1868 t13703 34686 NONSTRUCTURAL PROTEIN PNS7. >p 57 40b7t7 1946 t13781 34764 NUCLEAR LOCALIZATION SEQUENCE 77 51d4t7 2382 t14217 35200 NUCLEOLIN (PROTEIN C23). >pir| 66 46c11t7 2226 t14061 35044 Ng-CAM precursor - chicken | 0 58 45f4t7 2198 t14033 35016 Nocardia sp. No. Ch 2-1 cdh ge 65 B63TP 1727 T14285 35268 O2-EVOLVING ENHANCER PT-2 387 37c6t7 1397 t13331 34314 ODD-SKIPPED PROTEIN. >pir||S11 68 41e9t7 1987 t13822 34805 OLFACTORY RECEPTOR-LIKE PROTEI 57 38e9t7 1919 t13754 34737 OLFACTORY RECEPTOR-LIKE PROTEI 56 SCF3T7P 1021 T12955 33938 ORF 71 23D11T7 1107 T13041 34024 ORF (PIR::S11850) 159 41b9t7 1963 t13798 34781 ORF [Homo sapiens] 69 48f12t7 2341 t14176 35159 ORF [Vigna radiata] >gp|D14410 93 48b9t7 2321 t14156 35139 ORF1 for putative RNA binding 58 45f10t7 2196 t14031 35014 ORF8 protein - Autographa cali 66 B77XP 1757 T14315 35298 ORYZAIN ALPHA CHAIN PRECURSOR 464 B77TP 1756 T14314 35297 ORYZAIN ALPHA CHAIN PRECURSOR 181 36a11t7 1866 t13701 34684 ORYZAIN ALPHA CHAIN PRECURSOR. 212 20D1T7 1080 T13014 33997 ORYZAIN BETA CHAIN 526 32C6T7 1212 T13146 34129 ORYZAIN GAMMA CHAIN PRECURSOR 81 37H2T7 1416 T13350 34333 OSC4 GENE 79 1H5T7P 1070 T13004 33987 OXYGEN-EVOLVING ENHANCER PROT1 368 45e