From owner-bio-matrix@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!JUDY.ENG.UCI.EDU!liang From: liang@JUDY.ENG.UCI.EDU (liang) Newsgroups: bionet.molbio.bio-matrix Subject: CHINESES_BIOTECH_NET_FOUNDED Message-ID: <9312061945.AA20452@judy.eng.uci.edu> Date: 6 Dec 93 19:45:33 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 12 CBNet (Chinese Biotechnology Network) is a non-profit organization composed of professionals in biological, chemical, medical sciences, engineering and related fields. The CBNet sponsors the Chinese Biotechnology Internet Forum (CBIF) newsletter. To subscribe CBIF, please send an email to Listserv@UCSD.Edu with the message body: Add CB-Net. From owner-bio-matrix@net.bio.net Mon Dec 06 22:00:00 1993 Path: biosci!JUDY.ENG.UCI.EDU!liang From: liang@JUDY.ENG.UCI.EDU (liang) Newsgroups: bionet.molbio.bio-matrix Subject: CHINESES_BIOTECH_NET_FOUNDED Message-ID: <9312060500.AA19349@judy.eng.uci.edu> Date: 6 Dec 93 05:00:34 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 12 CBNet (Chinese Biotechnology Network) is a non-profit organization composed of professionals in biological, chemical, medical sciences, engineering and related fields. The CBNet sponsors the Chinese Biotechnology Internet Forum (CBIF) newsletter. To subscribe CBIF, please send an email to Listserv@UCSD.Edu with the message body: Add CB-Net. From owner-bio-matrix@net.bio.net Tue Dec 07 22:00:00 1993 Path: biosci!NET.BIO.NET!kristoff From: kristoff@NET.BIO.NET (David Kristofferson) Newsgroups: bionet.molbio.bio-matrix Subject: IMPORTANT BIOSCI INFORMATION Message-ID: <9312081000.AA27030@net.bio.net> Date: 8 Dec 93 10:00:09 GMT Sender: kristoff@net.bio.net Distribution: bionet Lines: 244 Three important items follow: BIOSCI archive searching by e-mail, the BIOSCI FAQ, and the BIOSCI User Address Directory form. If you have not yet listed yourself in our e-mail address directory, please take a few minutes to complete and return the form below. If your address information has changed since you listed yourself, please send us an updated form. Sincerely, Dave Kristofferson BIOSCI/bionet Manager kristoff@net.bio.net **** SEARCHING BIOSCI ARCHIVES WITH WAISMAIL **** E-mail users can search the BIOSCI archives by using our waismail e-mail server. For instructions send the message help to waismail@net.bio.net. Leave the Subject: line blank. Other methods of searching the archives via WAIS and gopher are described in the BIOSCI FAQ. **** BIOSCI FREQUENTLY ASKED QUESTIONS (FAQ) SHEET **** New users of BIOSCI/bionet may want to read the "Frequently Asked Questions" or "FAQ" sheet for BIOSCI. The FAQ provides details on how to participate in these forums and is available for anonymous FTP from net.bio.net [134.172.2.69] in pub/BIOSCI/biosci.FAQ or for retrieval by gopher to net.bio.net, port 70. It may also be requested by sending e-mail to biosci@net.bio.net (use plain English for your request). The FAQ is also posted on the first of each month to the newsgroup BIONEWS/bionet.announce immediately following the posting of the BIOSCI information sheet. **** BIOSCI USER ADDRESS DIRECTORY **** Please take this opportunity to add your name and address information to the BIOSCI User Address Database if you have not already done so. Below is the address form that we would like each reader of the BIOSCI/bionet newsgroups to complete and return if you would like to be listed in our database. The database serves as a directory that enables biologists, who are currently using (or even just reading) the BIOSCI newsgroups, to look up e-mail addresses and other information about our users. The address database is reindexed nightly for WAIS and waismail access (waismail is our WAIS e-mail server, more below) and will also be available for access via other gopher sites if they wish to permit it. The raw unindexed data is available for FTP from net.bio.net and is atomized sufficiently to allow import into your local RDBMS should you so desire. Please carefully follow the instructions for completing the form below and return it to either of the following two addresses (whichever is more convenient for you). Thanks in advance for taking the time to complete and return the form. Addresses for returning forms Location Network ----------------------------- -------- ------- biovote@net.bio.net U.S.A. Internet/BITNET biovote@daresbury.ac.uk U.K. JANET MAKING SURE THAT YOUR INFORMATION IS CURRENT This notice will be mailed bimonthly to each newsgroup. You should check our WAIS source or waismail e-mail server from time-to-time to see if your address information is still up-to-date. Send the message help to waismail@net.bio.net for instructions on using waismail. Leave the Subject: line in your message blank. Using Gopher to complete the form --------------------------------- If you don't want to use a text editor, you can also use Dan Jacobson's gopher site to fill out the address database form as follows. Otherwise skip this section on gopher and proceed to the instructions for filling out the form below. > To add yourself to the database just point your > gopher client at merlot.gdb.org and select the following: > > --> 15. Searching For Biologists/ > > --> 9. E-mail Addresses of Biosci-Bionet Users/ > > --> 1. Add (or Correct) Your Address to the BIOSCI User Address > Data.. > > > And fill out the form. or Rob Harper's gopher site in Europe as follows: > Europeans can point their gopher client at gopher.csc.fi and add their > information to the database. All entries will be mailed directly to > Dave for incorporation in a wais source. > > The path to the questionare is as follows. > > ---> 10. Finnish EMBnet BioBox/ > > ---> 8. FAQ Files/ > > FAQ Files > > 1. EMBnet: Information. > 2. EMBnet: Internet resources guide. > 3. A Biologist's Guide to Internet Resources/ > 4. All FAQs (Frequently Asked Questions) Searches and Archives/ > --->5. Bionauts Address Database (questionaire) IMPORTANT INSTRUCTIONS - PLEASE READ CAREFULLY Please enter all responses after the : on each line, leaving one (1) blank space after the : (i.e., before the start of your text). Please do NOT extend your responses past the end of each line (80 characters) or alter any of the field identifiers such as "first name: ". Several lines are provided at the end of the form for comments, but, please adhere to the line length restriction. On the date: line, please enter the date in the DD-MM-YY format, e.g., 05-05-93 for 5 May 1993. This line will tell others when the information was last updated. Please be sure to include the 0's for single digit days or months, e.g., 05-05-93, not 5-5-93. Note that the "e-mail network: " line below is for specifying, e.g., "Internet," "BITNET," "EARN," "JANET," or whatever other network that your computer may be on. If you are uncertain about any field, please feel free to leave it blank, but please DO NOT DELETE the field identifier from the form! In the first field below, "New information or Update ...", please enter "N" if this is the first time that you have registered in the directory or "U" if you are correcting a listing that you sent to us previously. The comment: lines may be used for anything that you like but PLEASE DO NOT DELETE THEM FROM THE FORM OR ALTER THEM. One suggested use is to list the names of the newsgroups in which you participate. Please use the MAILING LIST name (see below - the latest version of the list can be requested from biosci@net.bio.net) instead of the USENET name even if you don't participate by e-mail. WAIS might get confused by the periods in the USENET names. This allows one to retrieve via WAIS or waismail the list of participants in a particular group. For example: comment: ARABIDOPSIS PLANT-BIOLOGY BIONEWS On the comment: lines use these names below ---- NOT the USENET names below MAILING LIST NAME USENET Newsgroup Name ----------------- --------------------- ACEDB-SOFT bionet.software.acedb AGEING bionet.molbio.ageing AGROFORESTRY bionet.agroforestry ARABIDOPSIS bionet.genome.arabidopsis BIOFORUM bionet.general BIO-INFORMATION-THEORY bionet.info-theory BIONAUTS bionet.users.addresses BIONEWS bionet.announce BIO-JOURNALS bionet.journals.contents BIO-MATRIX bionet.molbio.bio-matrix BIO-SOFTWARE bionet.software CHROMOSOMES bionet.genome.chromosomes COMPUTATIONAL-BIOLOGY bionet.biology.computational DROSOPHILA bionet.drosophila EMBL-DATABANK bionet.molbio.embldatabank EMPLOYMENT bionet.jobs GDB bionet.molbio.gdb GENBANK-BB bionet.molbio.genbank GENETIC-LINKAGE bionet.molbio.gene-linkage HIV-MOLECULAR-BIOLOGY bionet.molbio.hiv HUMAN-GENOME-PROGRAM bionet.molbio.genome-program IMMUNOLOGY bionet.immunology INFO-GCG bionet.software.gcg JOURNAL-NOTES bionet.journals.note METHODS-AND-REAGENTS bionet.molbio.methds-reagnts MOLECULAR-EVOLUTION bionet.molbio.evolution NEUROSCIENCE bionet.neuroscience N2-FIXATION bionet.biology.n2-fixation PHOTOSYNTHESIS bionet.photosynthesis PLANT-BIOLOGY bionet.plants POPULATION-BIOLOGY bionet.population-bio PROTEIN-ANALYSIS bionet.molbio.proteins PROTEIN-CRYSTALLOGRAPHY bionet.xtallography RAPD bionet.molbio.rapd SCIENCE-RESOURCES bionet.sci-resources TROPICAL-BIOLOGY bionet.biology.tropical VIROLOGY bionet.virology WOMEN-IN-BIOLOGY bionet.women-in-bio YEAST bionet.molbio.yeast Listing newsgroups on the comment: line is optional, of course. Thanks again for your cooperation! --------------- please cut here and return portion below --------------- New information or Update to old record (enter N or U): date (DD-MM-YY): first name: middle initial: family name: job title: e-mail address: e-mail network: phone number: FAX number: institution: address1: address2: address3: city: state/province: country: postal code: research interest: research interest: comment: comment: comment: comment: comment: From owner-bio-matrix@net.bio.net Tue Dec 07 22:00:00 1993 Path: biosci!daresbury!doc.ic.ac.uk!uknet!pipex!uunet!olivea!sgigate.sgi.com!sgiblab!rpal.rockwell.com!headwall.Stanford.EDU!nntp.Stanford.EDU!nntp!brutlag From: brutlag@cmgm.stanford.edu (Doug Brutlag) Newsgroups: bionet.molbio.bio-matrix Subject: Intelligent Systems for Molecular Biology Conference Message-ID: Date: 8 Dec 93 23:18:18 GMT Sender: news@leland.Stanford.EDU (Mr News) Reply-To: ismb@camis.stanford.edu Followup-To: bionet.molbio.bio-matrix Organization: Stanford University Lines: 86 X-Newsreader: VersaTerm Link v1.1.1 ***************** CALL FOR PAPERS ***************** The Second International Conference on Intelligent Systems for Molecular Biology August 15-17, 1994 Stanford University Organizing Committee Deadlines Russ Altman, Stanford U, Stanford Papers due: March 11, 1994 Doug Brutlag, Stanford U, Stanford Replies to authors: April 29, 1994 Peter Karp, SRI, Menlo Park Revised papers due: May 27, 1994 Richard Lathrop, MIT, Cambridge David Searls, U Penn, Philadelphia Program Committee K. Asai, ETL, Tsukuba A. Lapedes, LANL, Los Alamos D. Benson, NCBI, Bethesda M. Mavrovouniotis, Northwestern U, Evanston B. Buchanan, U of Pittsburgh G. Michaels, George Mason U, Fairfax C. Burks, LANL, Los Alamos G. Myers, U. Arizona, Tucson D. Clark, ICRF, London K. Nitta, ICOT, Tokyo F. Cohen, UCSF, San Francisco C. Rawlings, ICRF, London T. Dietterich, OSU, Corvallis J. Sallatin, LIRM, Montpellier S. Forrest, UNM, Albuquerque C. Sander, EMBL, Heidelberg J. Glasgow, Queen's U., Kingston J. Shavlik, U Wisconsin, Madison P. Green, Wash U, St. Louis D. States, Wash U, St. Louis M. Gribskov, SDSC, San Diego G. Stormo, U Colorado, Boulder D. Haussler, UCSC, Santa Cruz E. Uberbacher, ORNL, Oak Ridge S. Henikoff, FHRC, Seattle M. Walker, Stanford U, Stanford L. Hunter, NLM, Bethesda T. Webster, Stanford U, Stanford T. Klein, UCSF, San Francisco X. Zhang, TMC, Cambridge The Second International Conference on Intelligent Systems for Molecular Biology will take place at Stanford University in the San Francisco Bay Area, August 14-17, 1994. The ISMB conference, held for the first time last summer in Bethesda, MD, attracted an overflow crowd, yielded an excellent offering of papers, invited speakers, posters and tutorials, provided an exciting opportunity for researchers to meet and exchange ideas, and was an important forum for the developing field. We will continue the tradition of pre-published, rigorously refereed proceedings, and opportunities for fruitful personal interchange. The conference will bring together scientists who are applying the technologies of advanced data modeling, artificial intelligence, machine learning, probabilistic reasoning, massively parallel computing, robotics, and related computational methods to problems in molecular biology. We invite participation from both developers and users of any novel system, provided it supports a biological task that is cognitively challenging, involves a synthesis of information from multiple sources at multiple levels, or in some other way exhibits the abstraction and emergent properties of an "intelligent system." The four-day conference will feature introductory tutorials (August 14), presentations of original refereed papers and invited talks (August 15-17). Paper submissions should be single-spaced, 12 point type, 12 pages maximum including title, abstract, figures, tables, and bibliography with titles. The first page should include the full postal address, electronic mailing address, telephone and FAX number of each author. Also, please list five to ten keywords describing the methods and concepts discussed in the paper. State whether you wish the paper to be considered for oral presentation only, poster presentation only or for either presentation format. Submit 6 copies to the address below. For more information, please contact ismb@camis.stanford.edu. Proposals for introductory tutorials must be well documented, including the purpose and intended audience of the tutorial as well as previous experience of the author in presenting such material. Those considering submitting tutorial proposals are strongly encouraged to submit a one-page outline, before the deadline, to enable early feed-back regarding topic and content suitability. The conference will pay an honorarium and support, in part, the travel expenses of tutorial speakers. Limited funds are available to support travel to ISMB-94 for those students, post-docs, minorities and women who would otherwise be unable to attend.. Please submit papers and tutorial proposals to: Intelligent Systems for Molecular Biology c/o Dr. Douglas L. Brutlag Beckman Center, B400 Department of Biochemistry Stanford University School of Medicine Stanford, California 94305-5307 From owner-bio-matrix@net.bio.net Wed Dec 08 22:00:00 1993 Path: biosci!daresbury!doc.ic.ac.uk!uknet!pipex!uunet!caen!batcomputer!ghost.dsi.unimi.it!genes!pongor From: pongor@genes.icgeb.trieste.it (Sandor Pongor) Newsgroups: bionet.molbio.bio-matrix Subject: Mail server for protein functional domain homologies - ICGEB Trieste Keywords: mail server, molecular biology, protein domains, sequences Message-ID: <1993Dec9.100700.21746@genes.icgeb.trieste.it> Date: 9 Dec 93 10:07:00 GMT Organization: ICGEB Lines: 148 SS BBB A SS EEEE H H EEEE L PPP S S B B A A S S E H H E L P P S B B A A S E H H E L P P S BB AAAAA S EEE HHHHH EEE L PPP S B B A A S E H H E L P S B B A A S E H H E L P S S B B A A S S E H H E L P SSS BBB A A SSS EEEE H H EEEE LLLL P ---------------------------------- This is the help file of the SBASE Email Server at the International Centre for Genetic Engineering and Biotechnology AREA Science Park, Padriciano 99, 34012 Trieste, Italy. ---------------------------------- The SBASE Email Server is at present experimental. Please send comments to sbase-comment@icgeb.trieste.it. Thanks. The SBASE e-mail server accepts a specially formatted mail message containing a protein query sequence, and, as a response, it sends the list of the most probable domain homologies. A database search is performed against the SBASE library of protein domains using the BLAST algorithm, and the search results, provided with annotations, are returned in a mail message. How to use: Getting HELP: ============ This help file can be gotten by sending an email to sbase@icgeb.trieste.it containing the word HELP alone in the first line of the message body. Making a QUERY: =============== Send e-mail to sbase@icgeb.trieste.it using the below example Note: the parameters before the token BEGIN are optional, (here the defaults are listed), the lines after BEGIN are required. Example: MATRIX PAM120 SCORE PARAMETER 35 ANNOTATIONS YES BEGIN > mysequence LRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYG GLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYG Response time ============= Requests are handled immediately, in serial order. At present, response time is quite short and is restricted by the network load rather than CPU availability. Please note that large output files, such as sometimes occur with very short query sequences, may need a long time to traverse the net. Evaluation of the output: ========================= The output of the server are BLAST search results against the SBASE protein domain library. The output file contains the BLAST search results, organized as follows: 1) List of the best scoring domain entries. As SBASE entries are named by domain names (function, structure, etc.), this list already may give some information on the expected domain composition. 2) List of alignments. For each SBASE entry you will find the complete annotation of the domain, followed by one (or several) alignments with (different parts of) the query. If one domain is found several times in your query, you may find several alignments with the same or related entries at different parts of the query. Please note that it depends on the score parameter whether or not you see all the alignments. Do not use very low cutoff values because that results in prohibitively long output files. (For the time being, we have set the default cutoff to 35 and the minimum cutoff to 30). 3) Run statistics. This is usually not essential for the evaluation of the results; you can get a complete description of these and other blast parameters by sending a HELP message to blast.ncbi.nlm.nih.gov Important: Failure to see a homology with a known domain may be due to several reasons: i) The domain type is not (yet) included in the SBASE domain library; ii) The threshold score parameter was set too high for the domain to be detected; iii) A different scoring matrix may be necessary in order to detect the alignment with the domain type in question. In the present experimental version of the SBASE server we support only the matrices used by BLAST; "customized matrices" will be added later to the final version. Papers to reference in reporting results: ========================================= Pongor, S., Skerl, V., Cserzo, M. and Hatsagi, Z., Simon, G. and Bevilacqua, V. (1992): The SBASE domain library release 2.0& A collection of annotated protein sequence segments, Nucleic Acids. Res , 21, 311-315 Altschul, Stephen F., Warren Gish, Webb Miller, Eugene W. Myers, and David J. Lipman (1990) Basic local alignment search tool J. Mol. Biol. 215:403-410. Software availability ===================== The Sbase database is available by anonymous ftp at ftp.icgeb.trieste.it:/pub/sbase2 The blast software is available by anonymous ftp at ncbi.nlm.nih.gov:/pub/ Protection of your sequence data ================================ The query sequences are not stored in any form. Further info: ============= Server functions: Zsolt Hatsagi Tel: +39-40-3757342 Valeria Bevilacqua, systems manager (valeria@icgeb.trieste.it) Tel.: +39-40-3757330 General info: Sandor Pongor Tel: +39-40-3757300 FAX: +39-40-226-555 Mail: International Centre for Genetic Engineering and Biotechnology AREA Science Park, Padriciano 99 34012 Trieste, Italy From owner-bio-matrix@net.bio.net Thu Dec 09 22:00:00 1993 Path: biosci!MBCMAIL.AB.UMD.EDU!collins From: collins@MBCMAIL.AB.UMD.EDU (John Collins) Newsgroups: bionet.molbio.bio-matrix Subject: protein sequencing lab Message-ID: <9312101415.A03090@mbcmail.ab.umd.edu> Date: 10 Dec 93 19:15:17 GMT Sender: daemon@net.bio.net Distribution: bionet Lines: 43 ---------------------------------- Forwarded ---------------------------------- From: John Collins Date: 12/10/93 2:18PM To: John Collins Subject: protein sequencing lab ------------------------------------------------------------------------------- Dear Colleague: I would like to call to your attention the availability of the PROTEIN SEQUENCING LAB, a core facility of the University of Maryland. We offer: PROTEIN/PEPTIDE SEQUENCING AMINO ACID ANALYSIS PEPTIDE MAPPING AND PURIFICATION BY HPLC IDENTIFICATION OF MODIFIED AMINO ACIDS DATABASE HOMOLOGY SEARCHES SECONDARY STRUCTURE PREDICTIONS HYDROPATHY PROFILES CONFIDENTIALITY EXPERIENCED, HELPFUL STAFF PERSONAL ATTENTION CONSULTATIONS PROPOSAL WRITING ASSISTANCE COLLABORATIONS FAST, QUALITY SERVICE COMPETITIVE PRICES Our mailing address is: Dr. John H. Collins Protein Sequencing Lab Dept. of Biological Chemistry Univ. Maryland School of Medicine 108 N. Greene St. Baltimore, MD 21201 For further information contact me, the lab director, John H. Collins, Ph.D., Professor of Medical Biotechnology and Biological Chemistry. tel: (410) 706-8102 fax: (410) 706-7364 e-mail: collins@mbcmail.ab.umd.edu From owner-bio-matrix@net.bio.net Sun Dec 12 22:00:00 1993 Path: biosci!daresbury!not-for-mail From: nfix@virgo (ing. Ivo Wiesner CSc.) Newsgroups: bionet.molbio.bio-matrix Subject: no subject (file transmission) Date: 13 Dec 1993 15:05:29 -0000 Lines: 18 Sender: daemon@mserv1.dl.ac.uk Distribution: bionet Message-ID: <2ei0bp$2mv@mserv1.dl.ac.uk> Original-To: biomatrx@dl.ac.uk Hello Everybody, I would greatly appreciate the advice about: is there any way to search for frequency of 8-10nt long nucleotide motifs within all available nucl.sequence databases without having CD-ROM on the bench? It is too short for submission to Quicksearch or Blast e-mail servers. Is there any workstation which could be open to such a service? I have altogether 15 motifs to be searched for their frequencies. Thanks much for any idea or suggestion!!! Ivo Wiesner nfix@virgo.jcu.cz From owner-bio-matrix@net.bio.net Sun Dec 12 22:00:00 1993 Path: biosci!daresbury!not-for-mail From: nfix@virgo.jcu.cz (ing. Ivo Wiesner CSc.) Newsgroups: bionet.molbio.bio-matrix Subject: no subject (file transmission) Date: 13 Dec 1993 15:43:31 -0000 Lines: 18 Sender: daemon@mserv1.dl.ac.uk Distribution: bionet Message-ID: <2ei2j3$4bn@mserv1.dl.ac.uk> Original-To: biomatrx@dl.ac.uk Hello Everybody, I would greatly appreciate the advice about: is there any way to search for frequency of 8-10nt long nucleotide motifs within all available nucl.sequence databases without having CD-ROM on the bench? It is too short for submission to Quicksearch or Blast e-mail servers. Is there any workstation which could be open to such a service? I have altogether 15 motifs to be searched for their frequencies. Thanks much for any idea or suggestion!!! Ivo Wiesner nfix@virgo.jcu.cz From owner-bio-matrix@net.bio.net Thu Dec 16 22:00:00 1993 Newsgroups: bionet.molbio.methds-reagnts,bionet.molbio.bio-matrix,bionet.molbio.proteins Path: biosci!daresbury!mrccrc!psansom From: psansom@crc.ac.uk (Mr. P.A. Sansom) Subject: Source of (rabbit) collagen I and III and antibodies to them. Message-ID: <1993Dec17.093319.28660@crc.ac.uk> Followup-To: poster Keywords: collagen, antibody, rabbit Sender: news@crc.ac.uk Nntp-Posting-Host: tin Organization: MRC Human Genome Resource Centre Date: Fri, 17 Dec 1993 09:33:19 GMT Lines: 2 Xref: biosci bionet.molbio.methds-reagnts:9878 bionet.molbio.bio-matrix:447 bionet.molbio.proteins:1156 From owner-bio-matrix@net.bio.net Tue Dec 21 22:00:00 1993 Path: biosci!daresbury!not-for-mail From: "" Newsgroups: bionet.molbio.bio-matrix Subject: New Bio-GOPHER at the IIB (Madrid-SPAIN) Date: 22 Dec 1993 12:21:12 -0000 Lines: 123 Sender: daemon@mserv1.dl.ac.uk Distribution: bionet Message-ID: <2f9e3o$22b@mserv1.dl.ac.uk> Original-To: biomatrx@dl.ac.uk Hi to you all. This is to announce the availability of an FTP and Gopher Server at the Biomedical Research Institute, at Madrid (SPAIN). Its name is Marduk.iib.uam.es The goodies described here are for the most part actually placed in the server, hence obtaining them from it doesn't suppose any hop to another remote server. In practic]e, almost everything that you find outside the folder "Gopher Links" is really placed in the very server. The most obvious exceptions are the links to the Spanish EMBNet node and to RedIRIS, the Spanish central InterNet node, placed at the upper level. With respect to software, this computer is mainly devoted to Mac Software. In the near future servers for UNIX, VMS or MS-DOS may be made available. As for now only a limited subset of VMS utilities are available there. ---------------------------------------------------------------------------- Databases: You can get the latest versions of Prosite, Blocks, TFD (with a version specially adapted for use with MacPattern --see Readme--), EPD, Alu and Berlin. If we can get enough band-width we'll try to maintain the FlyBase from Ashburner too. Documentation: We have installed a copy of the "Biocomputing Survival Guide" from the University of Basel. It is an excelent introductory book into Sequence Analysis with GCG, oriented to people who the closest computer thay have been was in the screen of a movie. I find it VERY interesting. It is in /pub/Docs/InterNet/BIOSCI-Bionet. The paper edition is to be released approximately by now. Please read carefully the Copyright notice and honor its author by paying the group fees. "Zen and The Art of the Internet" is the reference book to navigate the InterNet. A geme available in its but-last edition. It is in /pub/Docs/InterNet. The latest edition is available on paper, greatly enhanced from your local bookseller as a Prentice-Hall book. And to make it easier to introduce biologists to the InterNet, you can also get "A Biologist Guide To InterNet", a similar book written with biologists in mind. It is also in /pub/Docs/InterNet. Also, you can also get some hypertext guides for the Mac describing how to use the InterNet to neofits. You'll need HyperCard to use them. All published BioBits can be consulted from this server in /pub/Docs/InterNet/BIOSCI-Bionet/BioBit. They are general descriptions of different aspects of Bionet and common biocomputing problems edited by Rob Harper and published in Bio+Nauts through the las years. In addition you can also get the full collection of bulletins of the European Molecular Biology Network (EMBnet) from /pub/Docs/InterNet/EMBnet, as well as the EMBnet help files upon several general interest topics and an introduction to internet resources from the EMBnet viewpoint (Internet Resource Guide.EMBnet) We have arranged with the MIT to redistribute in this Gopher the electronic version of their journal JIR (the mini-JIR). The first issues ('93) are already available from /pub/Docs/Mini-J.I.R. From now on, all new issues will be kept there. And for computer addicts there is also a copy of the last edition of "The Hacker's Guide" in electronic form. The paper edition has just been released for sell in bookstores. It is in /pub/Docs/InterNet. Oh, and if you feel depressed you can always have a look to the contents of '/pub/Docs/Humour'... InterNet searches: We have links to a hugh amount of phone books all over the world as well as to a great variety of american libraries (and soon to spanish libraries) as well as to Project Gutenberg of electronic books. You'll find them in /pub/Gopher_Links. Note that these searches are available only through Gopher, but not to FTP users. Software: You can satisfy almost all your networking needs for the Mac with the software stored in this server. There are clients for FTP, Archie, Gopher, WAIS and even Mosaic. BTW, if you still haven't tried Mosaic, you should give it a chance. It's really impressive. And the same can be said of IRCL, a client for InterNet Relay Chat. In 'utilities' you'll also find the graphic converters needed to complete your environment and to access the latest standards (GIF, TIFF, JPEG...). There are also Mac compressors and -more inetresting- compatibility compressors like MacCompress (for .Z files) and coders like UUE/UUD for the Mac. We intend to make a mirror of EMBL software for the Mac in the near future. Please note that many of these programs are not PD, but ShareWare. Help us support it by paying the registration dues and honoring thier authors efforts. This is the only way to keep software prices reasonably low. ----------------------------------------------------------------------------- I hope that this server will prove useful to the Biological community. Please, address any comments, suggestions, etc... to JRValverde@Enlil.iib.uam.es they will be welcome. Just one last point. This computer is also used for other purposes and is shared by many users. Please be polite and consciously use it, but remember, YOU ARE WELCOME !!! J. R. Valverde Biomedical Research Institute Madrid - SPAIN From owner-bio-matrix@net.bio.net Sun Dec 26 22:00:00 1993 Path: biosci!rutgers!cs.utexas.edu!howland.reston.ans.net!nctuccca.edu.tw!TWNMOE10.Edu.TW!YMMCS023 From: YMMCS023@TWNMOE10.Edu.TW Newsgroups: bionet.molbio.bio-matrix Subject: compare DNA sequence on internet Message-ID: <16CB21B51.YMMCS023@TWNMOE10.Edu.TW> Date: 28 Dec 93 01:56:33 GMT Organization: MOE Computer Center, Taiwan Lines: 15 NNTP-Posting-Host: twnmoe10.edu.tw X-Newsreader: NNR/VM S_1.3.2 I got some sequences from human fetal brain cDNA. Where could I compare these uences with DNA bank (requiring no specific password) on internet to see if I h ave got something new or something old. Any information will be highly appresci ated. Sincerely CHEN-JEE HORNG, M.D. DEPARTMENT OF PSYCHIATRY VETERANS GENERAL HOSPITAL-TAIPEI TAIPEI, TAIWAN, R.O.C.