From owner-biophysics@net.bio.net Tue Oct 01 23:00:00 1996 Path: biosci!agate!spool.mu.edu!howland.erols.net!news-peer.gsl.net!news.gsl.net!usenet.eel.ufl.edu!warwick!kinguni!usenet From: Troadec Newsgroups: bionet.biophysics Subject: non invasive blood glucose sensors Date: Wed, 02 Oct 1996 14:16:20 -0700 Organization: Kingston University (Science) Lines: 4 Message-ID: <3252DBA4.4CC4@crystal.king.ac.uk> NNTP-Posting-Host: ku1452.king.ac.uk Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0 (Win16; I) To: bionet.biophysics I am looking for any informations about the latest developments in non invasive blood glucose sensors / instruments... Any help will be welcomed! Thank you. From owner-biophysics@net.bio.net Tue Oct 01 23:00:00 1996 Path: biosci!agate!howland.erols.net!newsfeed.internetmci.com!news.zeitgeist.net!wizard.pn.com!news.gte.com!news-in.tiac.net!uunet!in1.uu.net!news.u.washington.edu!kantola From: kantola@u.washington.edu (Angeline Kantola) Newsgroups: bionet.biophysics Subject: Re: double helix DNA molecule Date: 2 Oct 1996 17:15:28 GMT Organization: University of Washington, Seattle Lines: 21 Message-ID: <52u7vg$aht@nntp3.u.washington.edu> References: <199609301749.KAA26585@net.bio.net> <52sbke$jla@nntp3.u.washington.edu> NNTP-Posting-Host: carson.u.washington.edu Yesterday I wrote >Recently I ran across a paper model book of DNA structure--sort of a >'paper doll' book for DNA. It's got a double helix, as well as a set of >base pairs to illustrate complementarity and a (rather impressive and >sophisticated) model of a virus. This morning I found a request in my emailbox to post the ISBN. The book is called "DNA: The Marvellous Molecule", and it's by Borin Van Loon. ('DNA Explained!' is splashed across the front. Unfortunately, close examination has not revealed the key to my thesis project. So it goes.) It's got a double helix model, baculovirus model, nucleotide model, a wordy little 'minibook', and--bonus!--a storage box for your models. Some assembly required. ISBN is 0-906212-75-8; published by Tarquin Publications, Norfolk, England; copyright 1990. Cheers, AK From owner-biophysics@net.bio.net Tue Oct 01 23:00:00 1996 Path: biosci!agate!usenet.kornet.nm.kr!snunews.snu.ac.kr!usenet From: "Lee, Ji Hyun" Newsgroups: bionet.biophysics Subject: Non-duterated DPC(Dodecylphosphocholine) Date: Wed, 02 Oct 1996 18:34:37 +0900 Organization: College of Pharmacy, Seoul National University Lines: 17 Message-ID: <3252372D.6BAB@plaza.snu.ac.kr> Reply-To: newera@plaza.snu.ac.kr NNTP-Posting-Host: 147.46.8.60 Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0 (Win95; I) I have plan to elucidate structure of a micelle-bound peptide by NMR. For preliminary experiment I am trying to measure CD(Circular dichroism) spectrum of my peptide in several kinds of membrane-like detergent solutions such as SDS(sodium dodecylphosphate), DPC(Dodecylphosphocholine) and TFE(Trifluoroethanol). Now, I got a problem that I don't know how I can get such detergents especially DPC, DPG(Dodecylphosphoglycol) and TFE. 1. I'd like to have some information on how to contact with companies dealing with such detergent, eg. home page address etc. Of course since CD doesn't require deuterated detergent, I need non-deuterated DPC, DPG. 2. Could you tell me any newsgroup involved with such items. Send me either above, please. I searched sigma catalog for nothing. Thanks. From owner-biophysics@net.bio.net Tue Oct 01 23:00:00 1996 Path: biosci!faseb.org!cpk-news-feed1.bbnplanet.com!cpk-news-hub1.bbnplanet.com!www.nntp.primenet.com!nntp.primenet.com!howland.erols.net!newsfeed.internetmci.com!news-in2.uu.net!netnews.nwnet.net!news.u.washington.edu!kantola From: kantola@u.washington.edu (Angeline Kantola) Newsgroups: bionet.biophysics Subject: Re: double helix DNA molecule Date: 2 Oct 1996 00:05:34 GMT Organization: University of Washington, Seattle Lines: 19 Message-ID: <52sbke$jla@nntp3.u.washington.edu> References: <199609301749.KAA26585@net.bio.net> NNTP-Posting-Host: carson.u.washington.edu In article <199609301749.KAA26585@net.bio.net>, wrote: >I'm looking for a simple ("kitchen table") model of a double helix >DNA molecule. Anyone know of WWW sites or other ideas? Recently I ran across a paper model book of DNA structure--sort of a 'paper doll' book for DNA. It's got a double helix, as well as a set of base pairs to illustrate complementarity and a (rather impressive and sophisticated) model of a virus. I found this in a store catering to art and science supplies here in Seattle, but you might want to check your university book store or a large chain bookstore for something similar. If you'd like, write to me and I can send you more detailed information--exact author and title and the ISBN number. Cheers, Angie Kantola From owner-biophysics@net.bio.net Tue Oct 01 23:00:00 1996 Path: biosci!agate!spool.mu.edu!howland.erols.net!news-peer.gsl.net!news.gsl.net!usenet.eel.ufl.edu!warwick!kinguni!usenet From: Troadec Newsgroups: bionet.biophysics Subject: non invasive blood glucose sensors / instruments Date: Wed, 02 Oct 1996 13:46:44 -0700 Organization: Kingston University (Science) Lines: 3 Message-ID: <3252D4B3.1D8E@crystal.king.ac.uk> NNTP-Posting-Host: ku1452.king.ac.uk Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0 (Win16; I) do you have any news about this kind of sensors or instruments, the latest developments etc ??? thank you ! From owner-biophysics@net.bio.net Tue Oct 01 23:00:00 1996 Path: biosci!faseb.org!cpk-news-feed1.bbnplanet.com!cpk-news-hub1.bbnplanet.com!www.nntp.primenet.com!nntp.primenet.com!news-peer.gsl.net!news.gsl.net!usenet.eel.ufl.edu!warwick!kinguni!usenet From: Troadec Newsgroups: bionet.biophysics Subject: non invasive blood glucose sensors Date: Wed, 02 Oct 1996 14:11:14 -0700 Organization: Kingston University (Science) Lines: 4 Message-ID: <3252DA71.3F81@crystal.king.ac.uk> Reply-To: k958611@crystal.king.ac.uk NNTP-Posting-Host: ku1452.king.ac.uk Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0 (Win16; I) To: k958611@crystal.king.ac.uk I am looking for the latest development in non invasive blood glucose sensors / instruments for an essay . If you have any information , they will be welcomed . thank you... From owner-biophysics@net.bio.net Wed Oct 02 23:00:00 1996 Path: biosci!agate!howland.erols.net!news-peer.gsl.net!news.gsl.net!portc01.blue.aol.com!newstf01.news.aol.com!newsbf02.news.aol.com!not-for-mail From: scrimp@aol.com (SCRIMP) Newsgroups: bionet.biophysics Subject: Maxwells' Theory of Elect. and Light Date: 2 Oct 1996 21:24:45 -0400 Organization: America Online, Inc. (1-800-827-6364) Lines: 3 Sender: root@newsbf02.news.aol.com Message-ID: <52v4kt$mb5@newsbf02.news.aol.com> Reply-To: scrimp@aol.com (SCRIMP) NNTP-Posting-Host: newsbf02.mail.aol.com I'm looking for an English Version of Dr. Ludwig Von Boltzmann - Maxwells' Theory of Elect. and Light...... Anyone see one? Please Write me at SCRIMP@AOL.COM From owner-biophysics@net.bio.net Wed Oct 02 23:00:00 1996 Path: biosci!agate!howland.erols.net!www.nntp.primenet.com!nntp.primenet.com!news.primenet.com!news.primenet.com!not-for-mail From: johnson1@primenet.com (W. Travis Johnson) Newsgroups: bionet.biophysics Subject: Re: Math Models in Biology Date: 2 Oct 1996 20:49:05 -0700 Organization: Primenet Lines: 63 Message-ID: <52vd3h$s4g@nnrp1.news.primenet.com> References: <324eff5e.30596742@news.mcgill.ca> Reply-To: johnson1@primenet.com X-Posted-By: @206.165.21.154 (johnson1) X-Newsreader: Forte Free Agent 1.0.82 asheft@po-box.mcgill.ca (Alex Sheftel) wrote: >I am a Physiology undergraduate student at McGill University in a >course focussed on mathematical models in biology. Most of this topic >concerns chaos theory and fractals. For this course, a research paper >on a recent study/article on the subject is required. The article >cannot be of a McGill University professor and has to have been >written after 1993. >If anyone has any suggestions or references pertaining to articles >applying math to biological systems, I would greatly appreciate an >e-mail. > -Thanks, > Alex Sheftel You might try any molecular modeling studies of biological molecules such as proteins, peptides, DNA, hormones, etc. You could do a quick search of some papers concerning computer aided molecular modeling studies Eg. keywords: 'DNA and molecular modeling' or 'protein and modeling', etc. Two good general refs with improtant background to get you started are : Reference Type: Journal Article Record Number: 242 Author: Brooks, B R; Bruccoleri, R E; Olafson, B D; States, D J; Swaminathan, S; Karplus, M Year: 1983 Title: CHARMM: A Program for Macromolecular Energy, Minimization, and Dynamics Calculations Journal: Journal of Computational Chemistry Volume: 4 Issue: 2 Pages: 187-217 Keywords: molecular modeling DNA molecular mechanics Reference Type: Journal Article Record Number: 245 Author: Kollman, P A; Merz, K M Year: 1990 Title: Computer Modeling of the Interactions of Complex Molecules Journal: Accounts of Chemical Research Volume: 23 Issue: 8 Pages: 246-252 Keywords: molecular modeling Your job is to find the recent ones that relate to your specific topic. Good Luck ! Travis From owner-biophysics@net.bio.net Wed Oct 02 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Alexy Eroshkin Newsgroups: bionet.biophysics Subject: ANNOUNCE ProAnWin: protein alignment and structure-activity analysis Date: 3 Oct 1996 12:14:48 +0100 Organization: State Research Center of Virology & Biotechnology VECTOR Lines: 263 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <530778$qj2@mserv1.dl.ac.uk> Original-To: biophys@dl.ac.uk To: biophys@dl.ac.uk From: Alexey Eroshkin Subject: ANNOUNCE ProAnWin: protein alignment and structure-activity analysis ************************************** ProAnWin - Protein Analyst for Windows ************************************** State Research Center of Virology and Biotechnology Koltsovo, Novosibirsk Region, 633159 Russia and Irina Pika, Anatoly Frolov, Vladimir Ivanisenko with Alexey Eroshkin are pleased to announce the availability of new MS Windows application for multiple protein sequence alignment, comparative sequences analysis, studying protein structure-activity (property/phenotype) relationships and designing site-directed mutagenesis. DESCRIPTION: ProAnWin studies the relationships between protein/peptide activity (or property or related phenotype) and characteristics of some regions in primary or tertiary structure of these molecules. Structure-activity analysis is based on the sequences of protein family, data on protein activity (pK, ED50, Km or any other) and, if available, 3D structure of one of these proteins (supposing the common 3D fold for all the homologs). The main aim is to find out the factors responsible for the variation of protein activities: location of activity-modulating site and important structural characteristics of the site. The program makes the following: input of sequences from several formats (SWISS-PROT, PIR, FASTA, GCG, CLUSTAL) and 3D structure in PDB format; flexible multiple protein sequences alignment and threading sequences into known 3D structure (ClustalV + manual alignment); input of user-defined protein activities, properties or related phenotypes (with possibility to transform activity: log(x), 1/x, etc.); calculation of many characteristics (hydrophobicity, amphipathicity, etc.) of linear and spatial protein sites; fast multiple (up to eight independent factors) linear regression analysis of structure-activity relationships; activity prediction for untested or mutated proteins; data visualization (regression plots, 3D pictures with sites highlighted, multiple alignments); displaying found sites on sequences and 3D structure. The program has two main related windows - with protein sequences and with 3D structure; any site highlighted in sequences is highlighted in 3D structure and vise versa. ProAnWin aligns complete set of sequences, subset or any selected block, providing thus possibility for iterative alignment that preserve some previously found blocks or those imposed from some biological data (active center, catalytic residues). The program can be applied to analysis of various protein-related biological data, to prediction of activity (phenotype) of newly sequenced proteins and to simulation of protein-engineering experiments. DATA EXAMPLES: 1. The family of disintegrins (proteins from snake venom) with tested activity. Name Sequence (part) Activity* 41 51 61 71 81 Trigramin alpha QCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNP 130 Albolabrin .............MKK..I..R............I........ 222 Elegantin ..AD.......R.KKKR.I..R....NP..R.T.Q..D....G 136 Flavoridin ..AD.......R.KKKTGI.......FP..R.T.L.ND...WN 100 Batroxastatin ..A........R.KGA.KI..R....NP..R.T.Q..D....R 133 Applagin ..A........L.MK.....-R.....VN.....I........ 50 Kistrin ........E..K.SRA.KI...P...MP..R.T.Q..D...YH 128 Echistatin alpha E.ES.P..RN.L.LK...I.LR.....M......LTCP..... 56 Bitistatin ..NH.E.....K.KKAR.........WN....T.K.SD..W.H 237 Bitan alpha ..NH.E.....R.KKA..........WN....T.K.SD..W.H 108 * - Activity is measured as the concentration of protein (in nM) required to 50% attenuation of platelet-rich plasma aggregation stimulated by adenosine-diphosphate. 2. The set of synthetic peptides with tested antimicrobial activity Name Activity* Peptide sequence Analog A2 400 GIHYLSHKSFSKFFAGVGKFTNS Analog A1 100 GIHYLSHKSFSKFFAGVQKFTNS Antisense P 60 GIHYLSHKSFSKFFCGVQKFTNS Analog B1 40 GIHYLSHKSFSKFFKGVQKFTNS Analog B2 40 GIHYLSHKSFSKFFKGVGKFTNS Magainin 2 20 GIGKFLHSAKKFGKAFVGEIMNS Analog C1 20 GIHKLSHKSFSKFFKGVQKFTNS Analog C2 20 GIHKLSHKSFSKFFKGVGKFTNS Analog P1 10 AIHNFAHKSFAKFFRAVKKFANA Analog P2 5 AIHNLAHKSLAKLLRAVKKLANA Analog P3 5 GIHNFAHKSFAKFFRAVKKFANS Analog M2 3 KIHKLAHKLLKKLLKAVKKLAKA * - Minimal inhibitory concentration (in mcg/ml) against E.coli 3. The set of unrelated peptides with tested immunogenicity. ------------------------------------------------- Protein Oncogene Sequence Immuno- region genicity* ------------------------------------------------- 409-425 C-SRC RLIEDNEYTARQGAKFP 4 468-482 C-SRC NREVLDQVERGYRMP 4 499-508 C-SRC WRRDPEERPT 4 001-018 V-KI-RAS MTEYKLVVVGASGVGKSA 5 119-135 V-KI-RAS DLPSRTVDTKQAQELAR 5 161-175 V-KI-RAS REIRQYRLKKISKEE 2 001-018 V-HA-RAS MTEYKLVVVGARGVGKSA 4 001-018 C-HA(EJ)-RAS MTEYKLVVVGAVGVGKSA 3 001-018 C-HA-RAS MTEYKLVVVGAGGVGKSA 5 029-044 V-HA-RAS VDEYDPTIEDSYRKQV 4 091-108 V-HA-RAS EDIHQYREQIKRVKDSDD 4 126-136 V-HA-RAS ESRQAQALARS 4 146-155 V-HA-RAS AKTRQGVEDA 5 160-179 V-HA-RAS VREIRQHKLRKLNPPDESGP 5 011-024 V-MYB PQESSKAGPPSGTT 4 033-047 V-MYB MAFAHNPPAGPLPGA 3 146-162 V-MYB DNTRTSGDNAPVSCLGE 4 168-186 V-MYB PSPPVDHGCLPEESASPAR 4 170-185 V-MYB PPVDHGCLPEESASPA 2 247-260 V-MYB PFHKDQTFTEYRKM 4 247-265 V-MYB PFHKDQTFTEYRKMHGGAV 4 541-555 V-FES RHSTSSSEQEREGGR 4 584-593 V-FES PEVQKPLHEQ 4 782-796 V-FES FLRTEGARLRMKTLL 4 840-846 V-FES SREAADG 0 893-905 V-FES ASPYPNLSNQQTR 3 901-913 V-FES NQQTREFVEKGGR 4 222-234 V-MYC PPTTSSDSEEEQE 0 323-334 V-MYC RTLDSEENDKRR 4 340-350 V-MYC ERQRRNELKLR 4 363-371 V-MYC NNEKAPKVV 1 389-403 V-MYC RLIAEKEQLRRRREQ 4 395-405 V-MYC EQLRRRREQLK 4 400-406 V-MYC RREQLKH 0 * logarithm of antipeptide antibody titers. 4. Phenotype-genotype correlations. Influenza A virus M2 protein from strains sensitive (labeled "sen") and resistant to amantadine or rimantadine ("res"). Strain Sensitivity Sequence (N-terminal part only) PR8-34 res MSLLTEVETPIRNEWGCRCNGSSDPLAIAANIIGILHLILWILDR MON88 res ....................D.................T...... LEN3-83 res ..........................T...........T...... MOS88 res ..........................T...........T...... MON86 res ..........................T...........T...... SVER82 res ..........................T...........T...... WS33 res ....................D.....V.................. LEN85 res ....................D.....VV................. WSN33 res ....................D....FV.................. LEN49 res ....................D.....VV..........T...... LEN6-83 res ....................D...S.VV..S.............. SWONT81 res ....................D.....VA..S.............. SW29-37 res ....................D.....VA..S.............. SWIA30 res ..........T.........D.....VA..S.............. SWWIS61 res ..........T.S.......D.....VA..S.............. SWIA88 res .................K..D.....VAV.S.............. AA60 sen ....................D.....VV..S.............H KOREA68 sen ....................D.....VV..S......F....... BANG79 sen ....................D.....VV..S.............. FW50 sen ....................D.....VV..S.............. MEM88 sen ....................D.....VV..S.............. USSR77 sen .............Q......D.....VV..S.............. PINALB79 sen ..........T..G.E.K.SD.....V...S.............. SWHK82 sen ..........T..G.E.K.SD.....V...S.............. SWNED85 sen ..........T..G....FSD.....V...S.............. FPVR34 sen ..........T..G.E....D.....I...S............N. MLRDNY78 sen ..........T..G.E.K.SD.....V...S.............. TYMN81 sen ..........T..G.E.K.SD.....V...S.............. TYMN80 sen ..........T..G.E.K.SD.....V...S.............. CKVIC85 sen ..........T..G.E.K.SD.....V...S.............. ProAnWin IS USEFUL IN: - protein structure-function and structure-activity investigations; - designing proteins and peptides with improved activity; - making multiple protein alignments and getting sense from it; - studying phenotype-genotype correlations; - preparation of protein 3D pictures with sites highlighted; - comparative protein sequence analysis. AVAILABILITY: ProAnWin is available (as self-extracted archive) from EBI software library: ftp://ftp.ebi.ac.uk/pub/software/dos/proanwin and, in Eastern Hemisphere, from NSC software library: ftp://ftp.bionet.nsc.ru/pub/biology/vector/proanwin.dem/paw$.exe The version is limited in number of analyzed sequences. INSTALLATION: The files required to run ProAnWin are distributed in the form of a single compressed file. Create a directory "PROANWIN" in your hard disk, for example, C. Copy the file to the directory, run the file from DOS prompt and answer Yes to all questions. To start the program run PROAWIN.EXE from windows. PROGRAM CONTENT: Directory: Main directory - program modules DATA - examples of data and output files; amino acid physico-chemical properties (>50); manual ALIGNS - 50 aligned protein family sequences PUBLICATIONS: 1. Eroshkin A.M., Zhilkin P.A., Fomin V.I. Algorithm and computer program PROANAL for analysis of relationship between structure and activity in a family of proteins or peptides. CABIOS, 1993, 9, 491-497. 2. Eroshkin A.M., Minenkova O.O., Fomin V.A., Ivanisenko V.A., Ilyichev A.A. Analysis of peptide fragment insertions into major coat protein of bacteriophages M13, f1 and fd. Relation of protein structural characteristics and viability of mutant phages. Molec. Biology (Russia), 1993, 27, 1345-1355. 3. Eroshkin A.M., Fomin V.I., Zhilkin P.A., Ivanisenko V.A., Kondrakhin Y.V. PROANAL version 2: multifunctional program for analysis of multiple protein sequence alignments and studying structure-activity relationships in protein families. CABIOS, 1995, 11, 39-44. 4. Morozov B.M., Ivanisenko V.A., Eroshkin A.M., Ugarova N.N. Analysis of relations between bioluminescence color and the structure of beetle luciferases: identification of the sites influencing bioluminescence color. Molec. Biology (Russia), in press. Comments, bug reports, suggestions for new features are welcome and should be sent by e-mail to: Alexey Eroshkin OTHER TOOLS AVAILABLE: ProAnalyst, Multifunctional analysis of protein sequences and structures (MS-DOS version of ProAnWin with additional functionality: searching motifs, physico-chemical plots, alphabetical and physico-chemical analysis of protein sequence variation, structure-activity determination profile, etc.): IUBio archive: ftp://iubio.bio.indiana.edu/molbio/ibmpc/panalys1 EMBL library: ftp://ftp.ebi.ac.uk/pub/software/dos/proanalyst NSC library: ftp://ftp.bionet.nsc.ru/pub/biology/vector/proanaly.dem/panalys$ ProMSED, Protein Multiple Sequences EDitor for MS Windows 3.x/95 ("a la" Word for Windows style + ClustalV + manual alignment + amino acid coloring + more): EMBL library: ftp://ftp.ebi.ac.uk/pub/software/dos/promsed NSC library: ftp://ftp.bionet.nsc.ru/pub/biology/vector/promsed.dem/promsed$ IUBio archive: ftp://iubio.bio.indiana.edu/molbio/ibmpc/promsed1 ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ Dr. Alexey Eroshkin Institute of Molecular Biology E.mail: eroshkin@vector.nsk.su State Research Center of Virology and Tel: +7 (3832) - 647774 Biotechnology "Vector" Fax: +7 (3832) - 328831 Koltsovo, Novosibirsk Region 633159 Russia ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ From owner-biophysics@net.bio.net Thu Oct 03 23:00:00 1996 Path: biosci!agate!howland.erols.net!newsfeed.internetmci.com!demos!news.glas.apc.org!glas!yur77 From: Dmitry Yuryev Newsgroups: bionet.biophysics Subject: Unpleasant Theory of Vaccines Message-ID: Date: Fri, 04 Oct 1996 13:17:44 +0400 (WSU DST) X-Gateway: notes@glas.apc.org Lines: 48 This is an announcement of my very dissident article "Toward Understanding of Vaccines"; abstract is appended below, ull text is available from: http://www.glasnet.ru/~yur77/toward.htm It is VERY unplesant thing for immunology: the fact is that nobody else but Louis Pasteur was ostracized and even challenged to a duel after attempt to debate EXATLY this same theme in 1880. So, it's really not dull. Yet, from the biophysical point of view this work seems to be a rather obvious speculation on population dynamics. In this regard, I hope that, perhaps, my manuscript may find some interest among biophysicists. Please, pay special attention to the my speculation about attenuation of rabies virus (at the end of "Main Hypothesis" part); it's a crucial component of my theories, but I am afraid that it is lies too far beyond understanding of immunologists. ----------------------- TOWARD UNDERSTANDING OF VACCINES Dmitriy K.YURYEV e-mail yur77@glas.apc.org One of the dark secrets of modern medicine is that we still do not know what makes the smallpox vaccine (discovered 200 years ago) to function as a vaccine. This gap in our knowledge seems to be the most obvious cause of the failure to find an AIDS vaccine and, more generally, for failure of the whole "new generation" of high-tech vaccines. So to say, new vaccines do not work because it is not known why old ones work. The present speculative work reviews the entangled political and historical background of this problem and presents a hypothetical solution involving a simple explanation of the transmutation of virulent viruses into vaccines (called "attenuation" by L.Pasteur). It is based on two principal assumptions: 1. Contrary to the popular view that the immune system cannot cope with more than 25 antigens simultaneously, I think that this number is much larger, meaning that it may be possible to achieve protection from a rapidly mutating microbe by immunising against all its antigenic forms simultaneously. 2. This very technique is used at least in vaccines for rabies and smallpox, as these are actually cocktails containing complete repertoires of antigenic forms of the corresponding viruses, and not wild viruses undergone some miraculous "attenuating" mutation. If correct, these ideas promise nothing less than cures for AIDS, malaria and perhaps even for cancer. A great advantage is that experiments may be conveniently conducted on such disease as the common cold, for which a protective vaccine could be developed and tested after a few weeks of work From owner-biophysics@net.bio.net Thu Oct 03 23:00:00 1996 Path: biosci!bcm.tmc.edu!cs.utexas.edu!www.nntp.primenet.com!nntp.primenet.com!howland.erols.net!news-peer.gsl.net!news.gsl.net!portc01.blue.aol.com!newstf01.news.aol.com!newsbf02.news.aol.com!not-for-mail From: docbegood@aol.com (DocBeGood) Newsgroups: bionet.biophysics Subject: Re: GTP analogues Date: 3 Oct 1996 23:57:04 -0400 Organization: America Online, Inc. (1-800-827-6364) Lines: 3 Sender: root@newsbf02.news.aol.com Message-ID: <5321ug$q9u@newsbf02.news.aol.com> References: <324AC476.41C6@med.unc.edu> Reply-To: docbegood@aol.com (DocBeGood) NNTP-Posting-Host: newsbf02.mail.aol.com Try Biomole, a company out of PA, dedicated to supplying pharmacological tools for signal transduction. Many times if they dont list something in their catalog they may haev it available to inquiries. From owner-biophysics@net.bio.net Thu Oct 03 23:00:00 1996 Path: biosci!bcm.tmc.edu!cs.utexas.edu!howland.erols.net!news-peer.gsl.net!news.gsl.net!news-hk.gsl.net!news.gsl.net!newsgate.cuhk.edu.hk!hpg30a.csc.cuhk.hk!news.cuhk.edu.hk!sunrise.pku.edu.cn!csb0!owner From: owner@csb0 (Wang Arthur) Newsgroups: bionet.biophysics Subject: welcome to sbl Date: 4 Oct 1996 02:16:29 GMT Organization: Peking Univerity Lines: 49 Message-ID: <531s1t$dna@sunrise.pku.edu.cn> NNTP-Posting-Host: csb0.ipc.pku.edu.cn X-Newsreader: TIN [version 1.2 PL1] ********** Welcome to the Structural Biology List! ********** Structural biology has already drawn much attention: it opens the door to a new era of biology. We announce here that a mailing list for structural biologists has been created. It will bring biologists/chemists/pharmacists all across the globe together to a new electronic frontier. The list server locates at the Institute of Physical Chemistry, Peking University, Beijing, China. We send this mail to invite your membership. The suggested topics of this mailing list include: o Macromolecular crystallography o NMR and other spectroscopies o Molecular modeling and design o Structure-based drug design and QSAR o Bioinformatics o Theoretical and computational biology To subscribe, you only need to send a short mail to owner@ipc.pku.edu.cn like this, "please add me to the SBL ..." while stating your name, title, e-mail, address, country and academic interests. Or you can save your time by filling out the following form and send it back to owner@ipc.pku.edu.cn. No fee and no restriction to subscribe. --------------- Structural Biology Mailing List -------------- ---------------------- Membership Form ---------------------- Name: Title: Address: Country: E-mail: Academic interests: -------------------------------------------------------------- Please forward this message to your friends as many as possible. Thank you for concern. Prof. Luhua Lai Institute of Physical Chemistry Peking University, Beijing, P.R.China From owner-biophysics@net.bio.net Thu Oct 03 23:00:00 1996 Path: biosci!ipno.in2p3.fr!dorner From: dorner@ipno.in2p3.fr ("DORNER Georg", 5187) Newsgroups: bionet.biophysics Subject: uv-crosslinking on nylon membranes Date: 4 Oct 1996 10:16:00 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 16 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Since soon we will change our technique to fix dna on nylon membranes=20 (not positively charged!) from baking to uv-irradiation, I would like to=20 understand what really happens in detail on the membranes surface. Could=20 anybody explain how this process works without damage of the original dna? Thanks --------------------------------------------------------------------------- Georg Dorner INSTITUT de PHYSIQUE NUCLEAIRE= =20 B=E2t. 104 Tel: + 1.69.15.51.87 15, rue Georges Clemenceau Fax: + 1.69.15.71.96 F-91406 Orsay Cedex --------------------------------------------------------------------------- From owner-biophysics@net.bio.net Fri Oct 04 23:00:00 1996 Path: biosci!agate!howland.erols.net!newsfeed.internetmci.com!newsgate.compuserve.com!ix.netcom.com!netnews.worldnet.att.net!newsadm From: kenneth paul collins Newsgroups: bionet.biophysics Subject: Re: Unpleasant Theory of Vaccines Date: Sat, 05 Oct 1996 03:08:47 -0400 Organization: AT&T WorldNet Services Lines: 19 Message-ID: <3256097F.796C@postoffice.worldnet.att.net> References: NNTP-Posting-Host: 171.bridgeton-054.mo.dial-access.att.net Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 2.01E (Win95; I) Dmitry Yuryev wrote: > > This is an announcement of my very dissident article "Toward > > Understanding of Vaccines"; abstract is appended below, > [snip] > > 2. This very technique is used at least in vaccines for rabies and > > smallpox, as these are actually cocktails containing complete repertoires > > of antigenic forms of the corresponding viruses ...my view is that things have been going in this direction for a number of years already... no? ken collins _____________________________________________________ People hate because they fear, and they fear because they do not understand, and they do not understand because hating is less work than understanding. From owner-biophysics@net.bio.net Sat Oct 05 23:00:00 1996 Path: biosci!DARTMOUTH.EDU!Tomasz.Panz From: Tomasz.Panz@DARTMOUTH.EDU (Tomasz Panz) Newsgroups: bionet.biophysics Subject: Re: Cheap worldwide faxes using internet Date: 6 Oct 1996 07:38:12 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 5 Sender: daemon@net.bio.net Distribution: world Message-ID: <24087616@cupid.Dartmouth.EDU> NNTP-Posting-Host: net.bio.net Please, keep me informed. My e-mail address: Tomasz.Panz@dartmouth.edu All the best Tom From owner-biophysics@net.bio.net Sun Oct 06 23:00:00 1996 Path: biosci!daresbury!lyra.csx.cam.ac.uk!news.ox.ac.uk!news From: "Simon M. Brocklehurst" Newsgroups: bionet.biophysics Subject: NAOMI - important messages Date: Mon, 07 Oct 1996 09:41:01 +0100 Organization: University of Oxford Lines: 65 Message-ID: <3258C21D.167EB0E7@bioch.ox.ac.uk> NNTP-Posting-Host: nmrv.ocms.ox.ac.uk Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0 (X11; I; SunOS 4.1.3_U1 sun4m) NAOMI - Important messages to all users - please read. _____________________________________________________________________________ **** The NAOMI anonymous FTP server is now back up again after some considerable downtime. Sorry for all the inconvenience this caused. ----------------------------------------------------------------------------- **** I've taken this opportunity to make available the Version 3.0 User Guide which is complete reworking of the old User Guide. It is much improved (fast loading, better organised etc). It is available only on the Web site (select the User Guide - Europe link) at present. NAOMI Web site URL given below. Version 3.0 of the program is not yet available (release soon), but the new User Guide is applicable to the current version. ----------------------------------------------------------------------------- **** Due to bandwidth problems, especially across the Atlantic and to the Pacific Rim, I'm looking for places that would be prepared to act as mirror sites for the NAOMI distribution (you need an anonymous ftp server to do this). If you are interested in doing this, please e-mail me at: smb@bioch.ox.ac.uk ------------------------------------------------------------------------------ ****** What is NAOMI ? ******************* NAOMI is a computer program system for studying 3-D structures of proteins. NAOMI is available free of charge for academic users. NAOMI Version 2.4c is available as of now from the NAOMI Web site at: http://www.ocms.ox.ac.uk/~smb/Software/N_details/naomi.html or via anonymous ftp ftp://nmrz.ocms.ox.ac.uk/pub/smb/naomi i.e. at nmrz.ocms.ox.ac.uk in directory pub/smb/naomi/ _____________________________________________________________________________ | | ,_ o Simon M. Brocklehurst, | / //\, Oxford Centre for Molecular Sciences, Department of Biochemistry, | \>> | University of Oxford, Oxford, UK. | \\, E-mail: smb@bioch.ox.ac.uk | WWW: http://www.ocms.ox.ac.uk/~smb/ |____________________________________________________________________________ From owner-biophysics@net.bio.net Sun Oct 06 23:00:00 1996 Path: biosci!bcm.tmc.edu!cs.utexas.edu!swrinde!nntp.primenet.com!enews.sgi.com!EU.net!Belgium.EU.net!news From: Guy Cotton, LSD Newsgroups: bionet.biophysics Subject: Gamma rays and sterilisation (B) Date: 7 Oct 1996 21:57:55 GMT Organization: EUnet Belgium, Leuven, Belgium Lines: 25 Message-ID: <53bud3$th@news2.Belgium.EU.net> NNTP-Posting-Host: dialup11.liege.eunet.be Gamma rays and sterilisation (B) -------------------------------- I'm a dental surgeon and I send again this mail. I hope I will receive more answers and more precisions. I want to ask to the Specialists some questions: are the Gamma rays sterilize all the bacteriae and viruses ? One application is the Gamma's use for dental implants who are inserted in the maxillary bones. Do you think that Gamma rays will give all securities about sterilization? Wich dose will be like the best ? And this dose during how many time ? I hope you will give fundamental answers and all references as possible who will confirm the real effects of the Gamma rays. Please, answer on my private E-mail, undermentioned. Thank you very much and have a good day! Guy Cotton, LSD. (from Liege, in Belgium) Any question or suggestion or opinion will be appreciated on the SMTP From owner-biophysics@net.bio.net Sun Oct 06 23:00:00 1996 Path: biosci!agate!spool.mu.edu!howland.erols.net!news-peer.gsl.net!news.gsl.net!news-dc.gsl.net!news.gsl.net!news.NetVision.net.il!news From: noam hadas Newsgroups: bionet.biophysics Subject: Re: non invasive blood glucose sensors / instruments Date: Mon, 07 Oct 96 18:21:29 PDT Organization: NetVision LTD. Lines: 4 Message-ID: References: <3252D4B3.1D8E@crystal.king.ac.uk> NNTP-Posting-Host: ts023p14.pop3a.netvision.net.il Mime-Version: 1.0 Content-Type: TEXT/PLAIN; charset=US-ASCII X-Newsreader: NEWTNews & Chameleon -- TCP/IP for MS Windows from NetManage Try looking to Healthdyne Technologies (Marietta, GA). They are in last development phase of such a device. From owner-biophysics@net.bio.net Tue Oct 08 23:00:00 1996 Newsgroups: bionet.biophysics Path: biosci!faseb.org!cpk-news-feed1.bbnplanet.com!cpk-news-hub1.bbnplanet.com!www.nntp.primenet.com!nntp.primenet.com!feed1.news.erols.com!howland.erols.net!newsfeed.internetmci.com!in1.uu.net!hearst.acc.Virginia.EDU!murdoch!watt.seas.Virginia.EDU!cc9m From: cc9m@watt.seas.Virginia.EDU (Chi-Kai Chen) Subject: hydrodynamic of a sphere in a cylinder X-Nntp-Posting-Host: watt.seas.virginia.edu Message-ID: Sender: usenet@murdoch.acc.Virginia.EDU Organization: uva Date: Wed, 9 Oct 1996 22:27:21 GMT Lines: 28 Hello: I am studying the hydrodynamic behavior of a moving sphere in a cylinder under the low Reynold number condition (without flow). I know the study of the intercation between a sphere and a plane has been done before. Does anyone know of the study about interaction between a sphere in a cylinder for the sphere moving normal to the cylinder surface ? Another question is about superposition: If the incident angle of the sphere approaching a plain surface is between 0 and 90 degrees, i.e., there are x any y components in the velocity, can I superimpose the results of 1)translation parallel the plane and 2) moving normally towards the plane because of the linearity ? I will appreciate any help and hints you give me. Kevin From owner-biophysics@net.bio.net Tue Oct 08 23:00:00 1996 Path: biosci!agate!howland.erols.net!feed1.news.erols.com!arclight.uoregon.edu!super.zippo.com!zdc!zippo!drn From: strakhov@dir.iephys.msk.su Newsgroups: alt.sci.planetary,bionet.biophysics,bionet.microbiology,bionet.neuroscience Subject: Hunger strike in United Institute of Physics of the Earth, RAS, Moscow Date: 8 Oct 1996 02:31:17 -0700 Organization: United Institute of Physics of the Earth, RAS Moscow Lines: 78 Message-ID: <53d715$fue@lex.zippo.com> NNTP-Posting-Host: toy.paragraph.com Xref: biosci bionet.biophysics:2357 bionet.microbiology:7440 bionet.neuroscience:16066 FROM THE STATEMENT FOR THE PRESS by Academician V.N. Strakhov, General Director of UIPE RAS and I.I.Naumenko-Bondarenko, Chairman of Trade Union Committee of UIPE RAS. On September the 30th, 1996, we, academician Strakhov Vladimir Nikolaevich, General Director of UIPE RAS and Naumenko-Bondarenko Igor Ilyich, Chairman of the Trade Union Committee of UIPE RAS started a hunger strike in a protest against the policy of the Government of the Russian Federation with regard to Russian science in general and to the Russian Academy of Sciences in particular. This policy which has been conducted since 1992 has virtually resulted in a collapse of the Russian science, first of all of a branch one. Non-payments of budget financing in 1996 put a final and irrevocable elimination of the Russian science including the Russian Academy of Sciences on the agenda. The main features of the process of the agony of the Russian science are being defined by the following: a) a criminally low level of wages for an overwhelming majority of scientists, including Candidates and Doctors of Sciences which does not provide even a subsistence minimum; b) a heavy moral state of a majority of scientists caused by a miserable level of wages; c) a quick loss of professionalism of a higher level by a majority of scientific staff due to enormous stress; d) absence of young specialists inflow; e) a moral and physical wear of the material-technical basis of science; it is not possible to obtain the results of the world level without modern experimental equipment and modern computer technique; f) absence of a necessary level of informational supply of science ( by books, journals, telecommunications, work-shops, conferences etc.) At present a lag from a level of the world science for 5-7 years is equal to a complete death of science. The Russian science has been already lagging behind for five years. To develop a common state plan of reorganization of science it is necessary to be guided by long term considerations relating to a steady development of the country and its population: a) expenses for science are sure to be transferred to a number of protected articles of the budget; b) special programs on technical re-equipment of science, and first of all - the kept RAS Institutes, should be envisaged; c) a general level of expenses on science should annually grow, making 4% of the expenditure part of the budget in 1997, according to a recently adopted law. September 30th, 1996 United Institute of Physics of of the Earth, RAS. Moscow. TO ALL AND EVERYBODY ! A staff of UIPE RAS fully shares the demands of academician Strakhov Vladimir Nikolaevich, Director of the Institute, and Naumenko-Bondarenko Igor Ilyich, Chairman of the Trade Union Committee, who came forward with an extreme action, dangerous for their health, and appeals to the scientific community of Russia and the whole world to support this action by all the possible ways of a civic protest. Would you, please, convey this information on the present events to all the public and scientific collectives, to all the people capable of influencing the policy conducted by the government. Would you, please, inform us about your support and actions of protest carried out by you through E-mail: strakhov@dir.iephys.msk.su fax:(7 O95)255-60-40, 254-90-88 P.S. If you have an e-mailing list of appropriate organizations for sending the information you are free for using it. From owner-biophysics@net.bio.net Wed Oct 09 23:00:00 1996 Path: biosci!biosci!not-for-mail From: Larry Hunter Newsgroups: bionet.info-theory,bionet.molbio.bio-matrix,bionet.molbio.evolution,bionet.molbio.proteins,bionet.biophysics,bionet.general,bionet.molec-model,bionet.women-in-bio,bionet.xtallography Subject: Pacific Symposium on Biocomputing, Announcement and Call for Abstracts Date: 10 Oct 1996 16:05:44 -0700 Organization: National Library of Medicine Lines: 25 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Xref: biosci bionet.info-theory:4320 bionet.molbio.bio-matrix:772 bionet.molbio.evolution:5142 bionet.molbio.proteins:8973 bionet.biophysics:2360 bionet.general:23557 bionet.molec-model:1180 bionet.women-in-bio:5564 bionet.xtallography:2939 Pacific Symposium on Biocomputing Monday, January 6 through Thursday, January 9, 1997 Ritz Carlton Kapalua, Maui, Hawaii PSB '97 is an international, multidisciplinary conference for the presentation and discussion of current research in the theory and application of computational methods in problems of biological significance. Abstracts will be accepted until November 1, 1996. Please consult our web site for further information: http://www.cgl.ucsf.edu/psb -- Lawrence Hunter, PhD. National Library of Medicine phone: +1 (301) 496-9303 Bldg. 38A, 9th fl, MS-54 fax: +1 (301) 496-0673 Bethesda. MD 20894 USA email: hunter@nlm.nih.gov From owner-biophysics@net.bio.net Wed Oct 09 23:00:00 1996 Path: biosci!faseb.org!cpk-news-feed1.bbnplanet.com!cpk-news-hub1.bbnplanet.com!nntp-hub2.barrnet.net!news.sgi.com!news.sprintlink.net!news-peer.sprintlink.net!uunet!news-in2.uu.net!munnari.OZ.AU!metro!metro!wabbit.its.uow.edu.au!news From: n Newsgroups: bionet.biophysics Subject: Why electric charge knocks people out or even kills Date: Sat, 05 Oct 1996 22:56:08 +1100 Organization: / Lines: 6 Message-ID: <32564CD8.487D@spider.connectivity.net.au> Reply-To: asdfgh@spider.connectivity.net.au NNTP-Posting-Host: ppp01.connectivity.net.au Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0Gold (Win95; I) Hi all, I just curiouse about this issue, why high electric charges tends to knock out a person or even kills if it is sufficiently high. Does it has anything to do with the suddent surge of blood pressure, and heard attack ? From owner-biophysics@net.bio.net Thu Oct 10 23:00:00 1996 Path: biosci!daresbury!nntp-trd.UNINETT.no!sn.no!www.nntp.primenet.com!nntp.primenet.com!news.sgi.com!news.msfc.nasa.gov!newsfeed.internetmci.com!demos!news1.relcom.ru!EU.net!usenet2.news.uk.psi.net!uknet!usenet1.news.uk.psi.net!uknet!uknet!lyra.csx.cam.ac.uk!hgmp.mrc.ac.uk!news From: Mike Ferenczi Newsgroups: bionet.biophysics Subject: Re: Why electric charge knocks people out or even kills Date: Fri, 11 Oct 1996 08:36:11 +0100 Organization: NIMR Lines: 14 Message-ID: <325DF8EB.6441@nimr.mrc.ac.uk> References: <32564CD8.487D@spider.connectivity.net.au> Reply-To: m-ferenc@nimr.mrc.ac.uk NNTP-Posting-Host: nimp423.nimr.mrc.ac.uk Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0b6Gold (Win95; I) To: asdfgh@spider.connectivity.net.au An electrical shock interferes with the electrical transmission of impulses in the heart. If sufficiently strong, or of the wrong frequency etc., the shock will stop the heart, or will get the heart to beat in the wrong way. This may kill one prtetty quickly. n wrote: > > Hi all, > I just curiouse about this issue, why high electric > charges tends to knock out a person or even kills if it is > sufficiently high. Does it has anything to do with the suddent surge > of > blood pressure, and heard attack ? From owner-biophysics@net.bio.net Fri Oct 11 23:00:00 1996 Path: biosci!agate!ihnp4.ucsd.edu!news1.ucsd.edu!usenet From: Kevin Shreder Newsgroups: bionet.biophysics Subject: Updated WWWsite: The Antibody Resource Page Date: Sat, 12 Oct 1996 12:01:49 -0700 Organization: University of California at San Diego Lines: 34 Message-ID: <325FEB1D.35E3@ucsd.edu> NNTP-Posting-Host: chedccfx.ucsd.edu Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 2.0 (Macintosh; I; PPC) Updated WWWsite: The Antibody Resource Page The Antibody Resource Page, the first website devoted to bringing together the vast number of resources about antibodies on the net, has recently been updated. The page is designed to be browsed by the novice or expert and is divided into several sections: EDUCATIONAL RESOURCES ONLINE JOURNALS THE STUDY OF ANTIBODY RECOGNITION RESOURCES TO FIND ANTIBODIES SEARCHABLE DATABANKS AND DATABASES ANNOUNCEMENTS MISCELLANEOUS RESOURCES The fourth section is particularly large and contains information on ways to find antibodies (including how to obtain Linscott's Directory and the Manufacturers' Specifications and Reference Synopsis (MSRS) catalog), a large list of online companies that sell antibodies or antibody related products (over 60 links!), and a list of companies that sell antibodies that are not online. I am always looking for new information and new links, so if you know of something, please contact me. Or just contact me to let me know what you think of the page! The URL for the Antibody Resource Page is: http://www-chem.ucsd.edu/Faculty/goodman/antibody.html/abpage.html Kevin Shreder, Ph.D. University of California at San Diego kshreder@ucsd.edu From owner-biophysics@net.bio.net Sat Oct 12 23:00:00 1996 Path: biosci!sb.fsu.edu!diao From: diao@sb.fsu.edu (Diao Jia-Sheng) Newsgroups: bionet.biophysics Subject: (no subject) Date: 13 Oct 1996 14:32:43 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 3 Sender: daemon@net.bio.net Distribution: world Message-ID: <32615FED.41C6@sb.fsu.edu> NNTP-Posting-Host: net.bio.net -- Diao Jia-Sheng From owner-biophysics@net.bio.net Mon Oct 14 23:00:00 1996 Path: biosci!rutgers!uwm.edu!newsspool.doit.wisc.edu!night.primate.wisc.edu!tmpnews.crd.ge.com!news.crd.ge.com!rebecca!pauling.wadsworth.org!tivol From: tivol@news.wadsworth.org (William Tivol) Newsgroups: bionet.biophysics Subject: Re: Why electric charge knocks people out or even kills Date: 10 Oct 1996 17:01:27 GMT Organization: Wadsworth Center, NY Health Dept. Lines: 18 Message-ID: <53ja57$q89@pauling.wadsworth.org> References: <32564CD8.487D@spider.connectivity.net.au> NNTP-Posting-Host: alcor.wadsworth.org X-Newsreader: TIN [version 1.2 PL2] n (asdfgh@spider.connectivity.net.au) wrote: : Hi all, : I just curiouse about this issue, why high electric : charges tends to knock out a person or even kills if it is : sufficiently high. Does it has anything to do with the suddent surge : of : blood pressure, and heard attack ? The mechanism of damage by electric shock depends on the type of current (AC, DC, frequency & duration). High frequency AC produces burns, coagulation and/or necrosis in affected body parts. Low frequency AC can also cause burns. Primarily, however, nerve signals and their consequences are affected. This can result in fibrillation due to current through car- diac tissue, respiratory paralysis from current through the relevant nerves, muscle contraction--sometimes so violent that bones can be fractured, and loss of consciousness due to sensory overload. Yours, Bill Tivol From owner-biophysics@net.bio.net Tue Oct 15 23:00:00 1996 Path: biosci!bcm.tmc.edu!cs.utexas.edu!howland.erols.net!feed1.news.erols.com!uunet!news-in2.uu.net!ulowell.uml.edu!news.cs.umb.edu!oitnews.harvard.edu!NewsWatcher!user From: freeman_m@a1.tch.harvard.edu (Michael R. Freeman, Ph.D.) Newsgroups: bionet.biophysics Subject: Post-doc position available Date: Wed, 16 Oct 1996 16:22:33 -0500 Organization: Children's Hospital, Boston Lines: 21 Message-ID: NNTP-Posting-Host: 134.174.41.185 Post-doctoral Position--Available Immediately The project will involve development and targeting of novel fusion proteins to membrane-anchored growth factor precursors. A background in one of these areas is desirable: (1) construction and expression of engineered proteins (2) growth factor/receptor interactions (3) regulated proteolysis by soluble proteinases. Strong molecular biology and/or biochemistry skills are required. Salary and benefits are competitive. Dr. Michael R. Freeman Enders Research Laboratories, Rm. 1151 Children's Hospital, Harvard Medical School 300 Longwood Ave. Boston, MA 02115 e-mail: freeman_m@a1.tch.harvard.edu tel: 617-355-6054 From owner-biophysics@net.bio.net Tue Oct 15 23:00:00 1996 Path: biosci!UMBI.UMD.EDU!collins From: collins@UMBI.UMD.EDU ("John H. Collins, Ph.D.") Newsgroups: bionet.biophysics Subject: enzyme information Date: 16 Oct 1996 12:37:38 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 7 Sender: daemon@net.bio.net Distribution: world Message-ID: References: NNTP-Posting-Host: net.bio.net There are many books on the subject. On Wed, 9 Oct 1996, Kim Givskud Vineke wrote: > We are a group on Aalborg University in Denmark, and we are writing a > report on enzymes. > We are all fairly new on the subject, so could anybody send us some information > on enzymes etc. From owner-biophysics@net.bio.net Tue Oct 15 23:00:00 1996 Path: biosci!bloom-beacon.mit.edu!eru.mt.luth.se!newsfeed.luth.se!news.luth.se!newsfeed.sunet.se!news01.sunet.se!sunic!news.uni-c.dk!newsfeed.cs.auc.dk!rubin.but.auc.dk!31vineke From: Kim Givskud Vineke <31vineke@but.auc.dk> Newsgroups: bionet.biophysics Subject: Biotechnology Date: Wed, 9 Oct 1996 10:37:34 +0200 Organization: CS at Aalborg University Lines: 6 Message-ID: NNTP-Posting-Host: rubin.but.auc.dk Mime-Version: 1.0 Content-Type: TEXT/PLAIN; charset=US-ASCII We are a group on Aalborg University in Denmark, and we are writing a report on enzymes. We are all fairly new on the subject, so could anybody send us some information on enzymes etc. From owner-biophysics@net.bio.net Wed Oct 16 23:00:00 1996 Path: biosci!internet!biosci!not-for-mail From: biohelp (BIOSCI Administrator) Newsgroups: bionet.biophysics Subject: BIOSCI/bionet miniFAQ & Fundraiser Date: 17 Oct 1996 02:00:49 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 239 Sender: daemon@net.bio.net Distribution: world Message-ID: <199610170900.CAA19418@net.bio.net> NNTP-Posting-Host: net.bio.net (LAST REVISION: 30-JUL-95) This BIOSCI "miniFAQ" is designed to answer the questions that come up the *most frequently*. The main BIOSCI FAQ (Frequently Asked Questions) is accessible on the World Wide Web at URL http://www.bio.net/. If you can not find an answer to your question in this or other documentation, the BIOSCI technical support staff answers e-mail queries sent to biosci-help@net.bio.net We can only answer questions about the use of the newsgroups and mailing lists. We unfortunately do not have the staff to do Internet information searches or answer scientific questions. Please post those to the appropriate BIOSCI/bionet newsgroups. Contents: -------- 0) BIOSCI NEEDS YOUR SUPPORT!! 1) Using the WWW to access the BIOSCI/bionet newsgroups. 2) What to do about "spams," i.e., junk mail, ads, etc. 3) Examples of subscribing and unsubscribing to the mailing lists. 4) The BIOSCI user address and research interest directory. 0) BIOSCI NEEDS YOUR SUPPORT!! ------------------------------ BIOSCI's government funding has been expended, and we are now operating solely from advertising revenue that we have raised from our Web site at http://www.bio.net/. We need just a few minutes of your time to help us serve you. You can do two important things which will take very little time for you individually and will immensely help us continue to help you. First, please use our WWW system at http://www.bio.net/ to access the archives. You can post or reply to messages via your Web browser as described in item #1 below. Your usage helps attract sponsors. If you contact any of our sponsors, please be sure to thank them for supporting BIOSCI. It is critical for them to get this feedback if they are to continue their sponsorship for the long term. Second, if you work for a company or organization that provides products or services of interest to the biology community, please pass this message on to your marketing or marketing communications department or other appropriate group. Please ask them to help support BIOSCI by sponsoring our Web site and explain the uses and benefits of the system to the biology community. If they are interested, they can then contact us for further information at our tech support address, biosci-help@net.bio.net. 1) Using the WWW to access the BIOSCI/bionet newsgroups. -------------------------------------------------------- As of 10 December 1995, all BIOSCI/bionet full newsgroups are accessible through the World Wide Web (WWW) at URL http://www.bio.net. One can read and reply publicly or privately to both recent postings and archived messages through one's Web browser if it is configured properly to send e-mail. Each newsgroup is equipped with its own WAIS index. The main BIOSCI home page also has access to the BIO-JOURNALS Table of Contents database WAIS index and the BIOSCI user address database described in another item further below. 2) What to do about "spams," i.e., junk mail, ads, etc. ------------------------------------------------------- BIOSCI is a set of parallel USENET newsgroups (the "bionet" groups), mailing lists, and a hypermail archive at URL http://www.bio.net/. The same postings are distributed on all media (except for a small number of mailing-list-only groups at net.bio.net). Unfortunately it is becoming a despicable practice on the Internet (by a few people out to make a fast buck) to do automated mass postings to thousands of newsgroups and mailing lists. These attempts to grab free advertising are refered to as "spams" in the usual, somewhat boneheaded, net terminology. USENET is more susceptible to this practice, and many spams originate on the USENET groups and then are passed on to the mailing lists. However, spammers also get lists of mailing addresses and hit these too, so neither medium is immune. What should you do personally if you get junk mail? --------------------------------------------------- Just delete it and move on without reading it further. Filing a protest is becoming increasingly useless because spammers are often disguising the addresses where the messages are sent from. Unless you really understand Internet mail systems, your attempt at protest by sending replies to the message will often end up being sent to the address of an innocent person that the spammer is victimizing. What can BIOSCI/bionet do to protect its newsgroups? ---------------------------------------------------- The only solution currently available is to moderate the newsgroup. If this newsgroup is already moderated, then you are in good shape. Moderation protects the USENET distribution from about 95% of the spams that are being sent to date and protects the mailing lists completely. Moderation means, however, that someone has to take the time to review each message before it goes out. We have set up software here that simply allows the moderator to forward to an address at net.bio.net messages that (s)he wishes to have distributed. This takes no more time than that needed to read the message and pass it on, say about 1 min. per message. Most newsgroups currently have a discussion leader who is responsible for their newsgroup. The discussions leaders and their e-mail addresses are listed in the BIOSCI Information Sheet which is available on the Web at http://www.bio.net/. If a newsgroup is being hit with too many junk postings, please contact the discussion leader for that group and see if there is interest in moderating the group. Please do not assume that by simply posting a complaint to the newsgroup itself, anyone on the BIOSCI staff will act on your complaint. With close to 100 newsgroups to run, the BIOSCI staff has to rely on the discussion leaders of each newsgroup to report problems directly to us at biosci-help@net.bio.net. We will moderate any of our newsgroups if the discussion leader tells us that the readership of the group wishes to do so and if a moderator is willing to do the work. For most BIOSCI/bionet groups, this entails only a few minutes of work each day. Moderating a newsgroup will resolve probably 95% of the junk postings on the USENET distribution. Unfortunately there are easy ways for determined spammers to override the moderation mechanism on USENET, but we can protect our e-mail subscribers from unwanted postings if the newsgroup is moderated. You can also access our newsgroups over the WWW at URL http://www.bio.net. While this Web interface will not stop spammers from trying to post to the groups, this will give you yet another way, besides using USENET news, to keep the junk out of your personal mail files. For those of you with local USENET news systems, the Web interface will also give you faster access to new newsgroups and recent postings. 3) Examples of subscribing and unsubscribing to the mailing lists. ------------------------------------------------------------------ PLEASE NOTE: The BIOSCI management does NOT act on subscription/unsubscription requests that are posted improperly to the newsgroups and mailing lists. People who do this only bother everyone on the lists to no avail. Please be sure to follow the proper procedures below. Gory details are in the BIOSCI Information sheets on the Web at http://www.bio.net. Below we give an example utilizing the METHODS-AND-REAGENTS list at both of our two BIOSCI sites: Users in the Americas and Pacific Rim countries who use the BIOSCI ------------------------------------------------------------------ node at computer net.bio.net: ---------------------------- A) Determine the "listname" which is the <=8 character mail address ^^^^^^^^^^^^^ for the group. These can be found in the BIOSCI Info. Sheet. For the METHODS-AND-REAGENTS group the mailing address is methods@net.bio.net. The listname is the portion of the address to the left of the @ sign, i.e., "methods". The listname is used with the "subscribe" and "unsubscribe" commands illustrated below. B) Mail all commands in the body of a mail message addressed to biosci-server@net.bio.net. Do NOT send commands to the newsgroup posting addresses! Leave the Subject: line blank, any text on it will be ignored. C) In the body of your message put one or more of the following commands with an "end" command on the last line, e.g., subscribe methods unsubscribe methods end Do NOT put your e-mail address or other text on these lines. The server only allows you to cancel your subscription if the address on your mail header matches the address on our mailing list. Please ask for help at biosci-help@net.bio.net if your address has changed, e.g., if you know you are on the list but the server tells you that you are not a member. Users in Europe, Africa, and Central Asia who use the BIOSCI node at -------------------------------------------------------------------- computer daresbury.ac.uk (also known as dl.ac.uk): ------------------------------------------------- To subscribe and unsubscribe to/from the BIOSCI lists, you need to specify the full USENET newsgroup name with "bionet-news." prepended. The USENET newsgroup names are listed in the BIOSCI Information sheet on the Web at http://www.bio.net/. For the METHODS-AND-REAGENTS list the USENET newsgroup name is bionet.molbio.methds-reagnts, thus the appropriate commands are sub bionet-news.bionet.molbio.methds-reagnts unsub bionet-news.bionet.molbio.methds-reagnts These commands are included in a message addressed to mxt@dl.ac.uk, NOT to the newsgroup mailing addresses. As usual, include the text in the body of the message as text on the Subject: line is ignored. To unsubscribe from all the lists at the UK node, use unsub bionet-news Please note that if the address in the list is different than the one in your mail message header, you will not be able to unsubscribe by this method. If you have problems, please mail biosci@daresbury.ac.uk. 4) The BIOSCI user address and research interest directory. ----------------------------------------------------------- Please take this opportunity to add your name, address, and research interest information to the BIOSCI User Address Database if you have not already done so. You can fill out the address form directly through our Web page at URL http://www.bio.net/adrform.html. The address database is reindexed nightly for WWW access (the URL is http://www.bio.net/). If you are not directly on the Internet but can reach it by e-mail, please use our waismail server to access the user directory. waismail use is described above. You can also request a user address form by e-mail from biosci-help@net.bio.net. Please check your database entry from time-to-time to see if your address information is still up-to-date. Because of our limited personnel resources, we ask that you resubmit a *complete* form to revise your entry; we only replace complete entries and do not have resources to edit old forms. Sincerely, Dave Kristofferson BIOSCI/bionet Manager biosci-help@net.bio.net From owner-biophysics@net.bio.net Wed Oct 16 23:00:00 1996 Path: biosci!bcm.tmc.edu!cs.utexas.edu!howland.erols.net!news.sprintlink.net!news-peer.sprintlink.net!uunet!in1.uu.net!netnews.nwnet.net!news-hub.interserv.net!news.sprynet.com!news From: "David R. Marlborough" Newsgroups: bionet.biophysics Subject: Re: Biotechnology Date: Thu, 17 Oct 1996 18:38:29 -0400 Organization: Sprynet News Service Lines: 15 Message-ID: <3266B565.1086@sprynet.com> References: NNTP-Posting-Host: hd74-163.compuserve.com Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 2.01 (Win95; I) Kim Givskud Vineke wrote: > > We are a group on Aalborg University in Denmark, and we are writing a > report on enzymes. > We are all fairly new on the subject, so could anybody send us some information > on enzymes etc. To have a good understanding of enzymes one must have a basic knowledge of proteins! Your best bet is to get yourselves familiar with the properties of proteins before you start your research. Usually the mechanics of communication via enzymes is not extremely complex. An enzyme has a "source" and to get to a "receptor" it must have a mode of "transportation." You should be well on your way! PEACE From owner-biophysics@net.bio.net Wed Oct 16 23:00:00 1996 Path: biosci!agate!news.ucsc.edu!news.ieee.org!mvb.saic.com!news.mathworks.com!uunet!news-in2.uu.net!crc-news.doc.ca!usenet From: Jocelyne Voisin Newsgroups: alt.tv.discovery.canada,bionet.biophysics,bionet.microbiology,k12.ed.science,misc.education.science,sci.edu,soc.culture.canada,soc.history.science,ieee.eab.general Subject: How much do you know about Canadian scientists? Date: Thu, 17 Oct 1996 15:29:54 -0700 Organization: Industry Canada Lines: 17 Message-ID: <3266B362.4524@ic.gc.ca> NNTP-Posting-Host: voisin.jocelyne.sci000.ic.gc.ca Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 2.0 (Win16; U) Xref: biosci bionet.biophysics:2371 bionet.microbiology:7509 misc.education.science:8760 sci.edu:11822 soc.culture.canada:130373 soc.history.science:9596 On this first day of National Science and Technology Week, October 18, anyone in Canada can try the quiz on the Great Canadian Scientists site and match wits with the rest of the country. High scorers on that day will win Great Canadian Scientists t-shirts or a new Great Canadian Scientists CD-ROM. Although October 18 will be a special day for the web site quiz, it can be played by anyone at any time. The web site also includes an "Ask A Scientist feature," in which volunteer scientists respond to questions on a wide variety of topics. Some recent queries include: What mountains in British Columbia are volcanoes? and Can bubble gum be digested? Find out what happens to bubble gum when swallowed and much more with Canada's great scientists! Visit the site at http://www.science.ca or jump to the site from SchoolNet's Math/Science page! For more information, contact Jocelyne Voisin at (613) 954-1322: email voisin.jocelyne@ic.gc.ca From owner-biophysics@net.bio.net Wed Oct 16 23:00:00 1996 Path: biosci!specle.chel.su!Specle From: Specle@specle.chel.su ("Michael A. Sniggin") Newsgroups: bionet.biophysics Subject: We Need YOUR Help! Date: 17 Oct 1996 08:36:19 -0700 Organization: OOO Yguralspecavtomatick Lines: 28 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Gentlemen! Please, read this message over - this is not an ads or something like that. We are living in the South Urals, Russia and we are trying to connect our society, our people to the Internet by new technologies - just to have normal conditions to work with this Great Net. What we have now is just a mockery - sometimes 25 bytes/sec (!!!). But new equipment is very expensive. So we are trying to collect the sum we need by donations of persons holding the same views. If you sympathise our ideas and consider it possible to send us some money - it would be accepted with warm gratitude. We would be also very grateful to all advises too, our mail - specle@specle.chel.su Thank you for reading this message over, and - forgive us for taking your time. Yours virtually, Advance Tech Group. Please transfer ANY sum to the: BENEFICIARY: Lazarev Yuri Ivanovich, Russia ACCOUNT # 008100072 With Savings Bank Of Russian Federation (SBERBANK) C.H.I.P.S. Number 3212333 SWIFT Code - SABRRUMM Kurchatovskoe Branch 8053 In Favour Account # 7207001394/001 (for USD) # 7207000088/048 (for DM) From owner-biophysics@net.bio.net Thu Oct 17 23:00:00 1996 Path: biosci!ihnp4.ucsd.edu!agate!spool.mu.edu!howland.erols.net!cs.utexas.edu!newshost.convex.com!newsgate.duke.edu!news.duq.edu!newsfeed.pitt.edu!bb3.andrew.cmu.edu!casaba.srv.cs.cmu.edu!das-news2.harvard.edu!oitnews.harvard.edu!purdue!news.bu.edu!engpub6!zhiping From: zhiping@engpub6.bu.edu (Zhiping Weng) Newsgroups: bionet.biophysics Subject: postdoctoral position available for molecular modeling Date: 18 Oct 1996 03:59:16 GMT Organization: Boston University Lines: 8 Message-ID: <546val$1nu@news.bu.edu> NNTP-Posting-Host: engpub6.bu.edu Keywords: homologous modeling, docking, binding free energy calculation X-Newsreader: TIN [version 1.2 PL2] Postdoctoral positions are available in computational chemistry and protein modeling. Research focuses on algorithm and program development in the following areas (1) protein structure prediction by homologous extension; and (2) docking and binding free energy evaluation. Please send CV, and names and telephone numbers of 3 references to: S. Vajda, Department of Biomedical Engineering, Boston University, 44 Cummington St., Boston MA 02215. Phone: 617-353-4757, FAX: 617-353-6766, e-mail: vajda@enga.bu.edu From owner-biophysics@net.bio.net Mon Oct 21 23:00:00 1996 Path: biosci!ihnp4.ucsd.edu!munnari.OZ.AU!news.ecn.uoknor.edu!feed1.news.erols.com!howland.erols.net!newsfeed.internetmci.com!uwm.edu!newsspool.doit.wisc.edu!news.itis.com!news From: "Petr Kuzmic" Newsgroups: bionet.biophysics,bionet.software Subject: Enzyme kinetics: sofware available Date: 22 Oct 1996 15:47:11 GMT Organization: BioKin Ltd. Lines: 14 Message-ID: <01bbc030$1fe0a5c0$dbc3f3cd@dev> NNTP-Posting-Host: p79.itis.com X-Newsreader: Microsoft Internet News 4.70.1155 Xref: biosci bionet.biophysics:2374 bionet.software:16884 This is to announce the availability of the program DYNAFIT for statistical analysis of (bio)chemical kinetic data. The program runs on IBM-PC, Macintosh, S.G.I., DEC Alpha, and I.B.M. RISC-System/6000. It is described in P. Kuzmic (1996) Anal. Biochem. 237, 360-373. and available for download from http://www.biokin.com (Unix versions from http://uwmml.pharmacy.wisc.edu). Source (Fortran-77) was requested by the Quantum Chemistry Program Exchange, but first I need to clean it up a bit :) _____________________________________________________________ Petr Kuzmic * B i o K i n Ltd. * http://www.biokin.com From owner-biophysics@net.bio.net Sun Oct 27 22:00:00 1996 Path: biosci!rutgers!news.sgi.com!www.nntp.primenet.com!nntp.primenet.com!arclight.uoregon.edu!news.ibm.net.il!news.biu.ac.il!news.huji.ac.il!MARDER From: MARDER@agri.huji.ac.il (Jonathan B. Marder) Newsgroups: bionet.biophysics Subject: Re: irradiance unit conversion Date: Mon, 28 Oct 96 14:40:30 GMT Organization: Hebrew University Lines: 26 Message-ID: <552gku$1sc2_001@agri.huji.ac.il> References: <9609288465.AA846519380@ucsusa.ucsusa.org> NNTP-Posting-Host: marder.agri.huji.ac.il X-Newsreader: News Xpress Version 1.0 Beta #4 In article <9609288465.AA846519380@ucsusa.ucsusa.org>, goetze@ucsusa.org wrote: > > > dear Colleagues > > could someone pls re-enlighten me as to how i might convert from > kerg/cm2/s to umol/m2/s? though i could once do this in a snap, the > memory fails and my then-handy equivalence tables are no more. > First, you need to know the wavelength of the light - visible white light is mostly 400-700 nm. Energy per photon = 1200 eV divided by wavelength in nanometres. 1 eV per photon is equivalent to 96.6 kJ/mol. I'll let you convert kJ/m2 to kerg/cm2 yourself. Jonathan B. Marder , Department of Agricultural Botany E-mail: MARDER@agri.huji.ac.il | The Hebrew University of Jerusalem Phone: (08 or +9728) 9481918 | /\/ Faculty of Agriculture Fax: (08 or +9728) 9467763 |/ \ P.O.Box 12, Rehovot 76100, ISRAEL http://www.agri.huji.ac.il/~marder From owner-biophysics@net.bio.net Sun Oct 27 22:00:00 1996 Path: biosci!ucsusa.org!goetze From: goetze@ucsusa.org Newsgroups: bionet.biophysics Subject: irradiance unit conversion Date: 28 Oct 1996 05:25:33 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 22 Sender: daemon@net.bio.net Distribution: world Message-ID: <9609288465.AA846519380@ucsusa.ucsusa.org> NNTP-Posting-Host: net.bio.net dear Colleagues could someone pls re-enlighten me as to how i might convert from kerg/cm2/s to umol/m2/s? though i could once do this in a snap, the memory fails and my then-handy equivalence tables are no more. thx to anyone who can take time to respond. regards, Darren Goetze Staff Scientist goetze@ucsusa.org *** fiat experimentia quia vincit omnia veritas *** /=======================================================\ | The Union of Concerned Scientists | | 2 Brattle Square T:+1.617.547 55 52 | | Cambridge MA 02238-9105 F:+1.617.864 94 05 | | USA Web: http://www.ucsusa.org | \=======================================================/ From owner-biophysics@net.bio.net Mon Oct 28 22:00:00 1996 Path: biosci!rutgers!uwm.edu!nntp.primenet.com!winternet.com!alpha.sky.net!news.missouri.edu!hptemp1.cc.umr.edu!inn From: jsd@isc.umr.edu () Newsgroups: bionet.general,bionet.biophysics Subject: ICMCM Conference Announcement / CFP Date: 25 Oct 1996 15:28:34 GMT Organization: University of Missouri - Rolla Lines: 100 Distribution: world Message-ID: <54qmb2$d5h@hptemp1.cc.umr.edu> NNTP-Posting-Host: nitinol.isc.umr.edu Originator: jsd@nitinol Xref: biosci bionet.general:23812 bionet.biophysics:2378 ANNOUNCEMENT AND CALL FOR PAPERS Eleventh International Conference on Mathematical and Computer Modelling and Scientific Computing March 31 - April 3, 1997 Georgetown University Conference Center Washington, DC, USA The Eleventh International Conference on Mathematical and Computer Modelling and Scientific Computing is scheduled to take place March 31-April 3, 1997 at the Georgetown University Conference Center, Washington, DC, U.S.A. Plenary lectures by world-renowned scientists and technical sessions on many recent developments in engineering and sciences comprise a long-standing tradition at the ICMCM's. Mathematical and computer modelling and scientific computing have become powerful tools for solving complex problems and providing greater insights into the future. The objective of the conference is to bring together researchers from various disciplines including the traditional and emerging areas of engineering and sciences for cross-fertilization of ideas and exchange of information. In view of the phenomenal growth in mathematical modelling activities and computational technologies, we can bring about further developments by focusing on the issues of mutual concern and through exchange of ideas. These developments are expected to offer us a global perspective and lead us, on a rational basis, to the solution of problems which continually arise in human endeavor. Papers are invited on all aspects of mathematical and computer modelling and scientific computing for presentation at the 11th ICMCM & SC. Papers will be chosen on the basis of one-page (about 200-250 words) abstracts clearly defining the work and its conclusions. Abstracts may be submitted in hard copy or via fax or by e-mail. The abstracts must be formatted to fit on 8-1/2 x 11 inch (approximately 21.5 cm x 28 cm or European Standard A-4 size) paper, typed in single space. The paper title must be capitalized and centered followed by author's name(s), institution, and full address. Send two copies (one copy if sent by fax or e-mail) of abstract and technical inquiries to: SCIENTIFIC PROGRAM COMMITTEE ELEVENTH ICMCM & SC P.O. BOX 31670 ST. LOUIS, MISSOURI 63131 USA or FAX to: (573)-364-3351 or e-mail to: avula@umr.edu IMPORTANT DATES: Closing Date for receiving abstracts: November 30, 1996 Notification of acceptance: December 27, 1996 Full length manuscripts (limited to six pages) of papers presented at the conference will be published in the Conference Proceedings which will be brought out as a special issue of the journal MATHEMATICAL MODELLING AND SCIENTIFIC COMPUTING, Vol. 8, 1997 (ISSN 1067-0688). The manuscripts for the special issue are due June 15, 1997. The special issue of the journal will be published by September 1997. TOPICS: Mathematical modelling and computation in engineering and sciences; computational sciences and technologies; applied mathematics and modelling methodologies; advances in numerical methods; systems theory; computational control; self-organizing systems; fuzzy and neuro-control; neural networks theory and applications; adaptive and smart structural systems; mechanics of solids and fluids; heat transfer; design optimization; damage mechanics; nondestructive evaluation; vehicle and occupant dynamics; composite, metal matrix, and shape-memory material systems; computational mechanics; computational materials modelling; diagnostics; supercomputing; software development; parallel processing; pattern recognition; inverse problems in engineering and science; environmental sciences; biomedical systems; computational physics; ETC., The 11th ICMCM & SC is co-chaired by Prof. Anil Nerode, Director, Mathematical Sciences Institute, Cornell University and Prof. Xavier J. R. Avula, Founder, ICMCM's, University of Missouri-Rolla. Keynote Lectures Scheduled So Far: 1. Paul J. Werbos, National Science Foundation, Arlington, VA, USA From Approximate Dynamic Programming to Brain-Like Intelligence: Closing the Gap 2. Hans-J. Zimmermann, Technical University Aachen, Germany Recent Advances in Fuzzy Technology and Computational Inelligence 3. Hwa A. Lim, HYSEQ, Inc., Sunnyvale, CA, USA Computational Science: A Means to Federate Biodata and Bioknowledge Through Bioinformatics ........and more. For further details and registration information, write to the Program Committee at the addresss in St. Louis given above, or call or e-mail to Prof. X.J.R. Avula at (573)-341-4585 or avula@umr.edu or FAX to (573)-364-3351. **************** From owner-biophysics@net.bio.net Tue Oct 29 22:00:00 1996 Path: biosci!bcm.tmc.edu!cs.utexas.edu!howland.erols.net!news3.cac.psu.edu!news.cse.psu.edu!news.cc.swarthmore.edu!netnews.upenn.edu!news.tju.edu!usenet From: "C. D. Stubbs" Newsgroups: bionet.biophysics Subject: Post Doc Position Date: Tue, 29 Oct 1996 15:58:50 -0500 Organization: Thomas Jeffrerson University Lines: 11 Message-ID: <3276700A.3E5C@jeflin.tju.edu> NNTP-Posting-Host: stubbs1.cgs.tju.edu Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0Gold (Win95; I) Postdoctoral Position is available to study the mechanism of activation and regulation of protein kinase C and related proteins at the cellular and sub-cellular level (e.g. see JBC 271, p4627; 270, 6639;269, p4866 &17160). A strong background in biochemistry and signal transduction with expertise in molecular biological techniques required. Applicant must have gained a Ph.D. within the last 3 yrs. Please send or email curriculum vitae and names of three references directly to: C. D. Stubbs Ph.D. (stubbsc@jeflin.tju.edu) Room 271, Department of Pathology and Cell Biology, Thomas Jefferson University, 1020 Locust St., Philadelphia PA 19107. see also: http://jeffline.tju.edu/CWIS/DEPT/Pathology/ARC/cdslab.htm From owner-biophysics@net.bio.net Tue Oct 29 22:00:00 1996 Path: biosci!bcm.tmc.edu!cs.utexas.edu!howland.erols.net!vixen.cso.uiuc.edu!news.stealth.net!newsfeed.uk.ibm.net!news-m01.ny.us.ibm.net!newsjunkie.ans.net!newsfeeds.ans.net!newstf01.news.aol.com!newsbf02.news.aol.com!not-for-mail From: ssihouston@aol.com (Ssihouston) Newsgroups: bionet.biophysics Subject: JOB - CLINICAL ENGINEERING TECH Date: 30 Oct 1996 15:29:52 -0500 Organization: America Online, Inc. (1-800-827-6364) Lines: 104 Sender: root@newsbf02.news.aol.com Message-ID: <558ds0$g5a@newsbf02.news.aol.com> Reply-To: ssihouston@aol.com (Ssihouston) NNTP-Posting-Host: newsbf02.mail.aol.com CLINICAL ENGINEERING TECHNICIANS (CET, 2) - Austin & Houston, Texas Area. Summary: This individual will be responsible for operating prototype, noninvasive, light based, clinical data collection systems and pre-production and production units of same in conjunction with client physicians and nurse practitioners. The CET will operate systems in laboratories at the Austin facilities, and in gynecological laboratories and clinics in Houston and other national sites. The CET will be trained in the operation of multiple systems types, will perform minor maintenance and troubleshooting, will collect clinical data and device performance data, and will be responsible for efficient data storage and transmission. The individual will be trained to perform under ISO 9000, Good Clinical Practice (GCP), Good Laboratory Practice (GLP), current Good Manufacturing Practice (GMP), and other relevant, world-class medical device performance standards. As a representative of the company, the CET will interact daily with patients, physicians, scientists, vendors and team members while maintaining a professional demeanor and appearance. Duties and Responsibilities (successful candidates will have experience with each of the following items): * Learn the operation and limited troubleshooting of prototype photonic clinical systems * Learn relevant aspects of Design Control, learn regulations of the federal Food and Drug Administration (FDA), cGMP, GCP, GLP and learn and apply company Standard Operating Procedures (SOPs) * Operate prototype diagnostic devices in a clinical setting in accordance with training * Collect patient data as required using Clinical Data Collection forms * Observe performance of equipment in the hands of clinical users * Observe patient interaction with the patient contact system * Decontaminate patient contact systems * Prepare detailed written reports of operator and patient interaction with systems * Prepare written design suggestions and performance reports for equipment designers * Perform and document equipment experiments with animal tissue, human tissue, and optical models * Collect, store and transmit digital data files * Interact with clinical specialists and patients as part of a clinical research team * interact with suppliers and contractors with purchase orders, confidentiality agreements, contracts, drawings, e-mail, fax and phone communications * Operate diagnostic devices in compliance with the laws and regulations of the United States and the FDA * Protect patient confidentiality in conformance with the requirements of the Department of Health and Human Services and the FDA Minimum Qualifications Include: Education: At least a four-year degree in Biology, Engineering, Nursing, Medical Laboratory Technology or physical sciences. Advanced degree holders in these fields and particularly in the fields of engineering are encouraged to apply. Specialized Skills and Knowledge Required: * Familiarity with learning and complying with regulations. FDA, ISO 9000, cGMP, GLP, and GCP knowledge is essential. * Familiarity with operating and minor troubleshooting of optical elements such as fiber optics, lenses and mirrors, lamps and lasers. Skill in the use of power meters or spectrometers is essential. * Familiarity with operating and minor troubleshooting of electronic instruments. Previous experience with or skill in the use of an oscilloscope is essential. * Meticulous documentation skills, including familiarity with specifications, experiment reports or lab notebooks and purchase orders. Skill in data file management and data manipulation. * Skill in the use of Microsoft Word and Excel. Skill in transferring data on the Internet. Skill in the use of Labview or Matlab would be beneficial. Experience Required: * Experience working in a rapid paced environment, self-supervising, setting and performing priorities, and communicating efforts and results to other members of a Project Team. * Experience in verbal and written communication with physicians, patients, professionals and suppliers. * Experience with data file collection, creation, transfer, manipulation and storage. * Experience with equipment calibration logging, patient data accrual and spread sheet use. * The individual will be required to maintain a professional appearance at all times. LOCATION: Duties will be performed in laboratories at Austin, Texas about three days per month. Initial training may require two weeks in Austin, Texas . Most of the duties will be performed in hospital settings in Houston, Texas. Some future travel including short term assignments will be required to train and support equipment operators in other cities in the U.S. and overseas. The are no relocation expenses available for this position. Please send your resume to: David W. Walters, Ph.D. Senior Scientific Recruiter ScienStaff, Inc. ssihouston@aol.com http://www.net-solutions.com/ScienStaff 7007 Gulf Freeway, Suite 239 Houston, Texas 77087 Phone: 713-640-1929, FAX: 713-640-1942 From owner-biophysics@net.bio.net Tue Oct 29 22:00:00 1996 Path: biosci!mayo.edu!clapham From: clapham@mayo.edu ("Clapham, David E., M.D.", David Clapham) Newsgroups: bionet.biophysics Subject: David Clapham's new address Date: 30 Oct 1996 12:19:13 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 32 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Dear Colleagues After November 20, my address will change from the Mayo Foundation in Rochester, MN, to the following: David E. Clapham MD, PhD Room 1309 Enders Building Children's Hospital Medical Center Harvard Medical School 320 Longwood Avenue Boston, MA 02115 Phone: 617-355-8628 FAX: 617-738-9579 Email: clapham@a1.tch.harvard.edu Secretary: 617-355-6163 FAX: 617-730-0692 David David Clapham Department of Pharmacology Guggenheim 711B Mayo Foundation Rochester, MN 55905 507-284-5881 FAX 507-284-9111 Email clapham@mayo.edu From owner-biophysics@net.bio.net Tue Oct 29 22:00:00 1996 Path: biosci!bcm.tmc.edu!cs.utexas.edu!howland.erols.net!www.nntp.primenet.com!nntp.primenet.com!arclight.uoregon.edu!newsfeed.direct.ca!portc01.blue.aol.com!newstf01.news.aol.com!newsbf02.news.aol.com!not-for-mail From: ssihouston@aol.com (Ssihouston) Newsgroups: bionet.biophysics Subject: Biophysical Programmer Wanted Date: 30 Oct 1996 14:39:51 -0500 Organization: America Online, Inc. (1-800-827-6364) Lines: 45 Sender: root@newsbf02.news.aol.com Message-ID: <558au7$enm@newsbf02.news.aol.com> Reply-To: ssihouston@aol.com (Ssihouston) NNTP-Posting-Host: newsbf02.mail.aol.com Job Title: Junior Programmer Placement Type: Permanent, Direct-hire, Exempt Position with Benefits Reports to: Manager of Research and Development Work Schedule: Monday - Friday, 1st shift, Approximately 40 hours a week. Job Description: This position is for a junior programmer to work in computer program development in a small Research and Development department of a software producer in Northwest Houston. The department in which this programmer will work consists of a Manager and three to four programmers. Approximately 70% of the programmers time will be devoted to programming and development, where as, the remaining approximately 30% of the time will be devoted to assorted tasks related to testing, evaluation, installation, release and technical support. The platforms are exclusively PC-based and there is no requirements for extensive minicomputer, main-frame computer, Mac or UNIX experience. Minimum Requirements: Graduation from an accredited four-year college or university with a degree in Computer Science or electrical engineering. Applicants with a Masters Degree in these disciplines will be given preference, but, a Masters Degree is not required. Intimate familiarity and demonstrable successful project-level experience with the following programs: 1. Microsoft Windows 3.1, Microsoft Windows for Workgroups 3.11 and Windows 95 2. C and C++ programming languages 3. Visual Basic 4. Microsoft Access 5. Various PC graphics programs to include presentation graphics Must have familiarity with and demonstrated successful project-level experience with PC platforms and PC networks Familiarity with communications program development is much preferred. Additional Information: Candidate must be made aware that there is a strong possibility of the company relocating to northern California within 6-12 months, and, the position will transfer with the company. Applicants willing to relocate with the company are much preferred to those unwilling to relocate. David W. Walters, Ph.D. Senior Scientific Recruiter ScienStaff, Inc. ssihouston@aol.com http://www.net-solutions.com/ScienStaff 7007 Gulf Freeway, Suite 239 Houston, Texas 77087 Phone: 713-640-1929, FAX: 713-640-1942 From owner-biophysics@net.bio.net Tue Oct 29 22:00:00 1996 Path: biosci!bcm.tmc.edu!cs.utexas.edu!news.sprintlink.net!news-peer.sprintlink.net!uunet!in3.uu.net!newstf01.news.aol.com!newsbf02.news.aol.com!not-for-mail From: ssihouston@aol.com (Ssihouston) Newsgroups: bionet.biophysics Subject: JOB - FDA REGULATORY AFFAIRS VP Date: 30 Oct 1996 15:35:45 -0500 Organization: America Online, Inc. (1-800-827-6364) Lines: 29 Sender: root@newsbf02.news.aol.com Message-ID: <558e71$gat@newsbf02.news.aol.com> Reply-To: ssihouston@aol.com (Ssihouston) NNTP-Posting-Host: newsbf02.mail.aol.com Job Description: Regulatory Affairs Officer, Director or Vice President for Medical Device Company manufacturing catheters. Salary is $70-100 K per year, with bonus and stock options. Prefer either a MD or Ph.D. This is a hands on position, with an assistant. There will be travel and interfacing with multi-site clinical trial personnel to include vascular surgeons, internal radiologists and cardiologists. Must be intimately familiar with all forms of regulatory FDA submissions to include 510(k), IDE, PMA, etc.. We also have an opening for a product development engineer in the medical devices field for a catheter manufacturer. Engineer will make drawings of devices, place in service devices and oversee the production line. The position is in Southern California. Salary range is $45-55K with bonus and stock options after two years. CAD/CAM a plus. If you believe your company maybe of assistance with filling either of these positions and would be willing to work together with ScienStaff, please contact: David W. Walters, Ph.D. Senior Scientific Recruiter ScienStaff, Inc. ssihouston@aol.com http://www.net-solutions.com/ScienStaff 7007 Gulf Freeway, Suite 239 Houston, Texas 77087 Phone: 713-640-1929, FAX: 713-640-1942 From owner-biophysics@net.bio.net Tue Oct 29 22:00:00 1996 Path: biosci!UMBI.UMD.EDU!collins From: collins@UMBI.UMD.EDU ("John H. Collins, Ph.D.") Newsgroups: bionet.biophysics Subject: DNA fingerprinting Date: 30 Oct 1996 14:27:11 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 11 Sender: daemon@net.bio.net Distribution: world Message-ID: References: <558au7$enm@newsbf02.news.aol.com> NNTP-Posting-Host: net.bio.net Will someone kindly send me a primer on this topic? * * * * * * * celebrating 10 years * * * * * * * * * John H. Collins, Ph.D. * * Professor * * Department of Molecular Biology and Biophysics * * Medical Biotechnology Center * * University of Maryland, Baltimore * * Baltimore, MD 21201 * * e-mail: collins@umbi.umd.edu * * * * * * * * * * * * at MBC * * * * * * * * * * * From owner-biophysics@net.bio.net Wed Oct 30 22:00:00 1996 Path: biosci!biosci!not-for-mail From: Larry Hunter Newsgroups: bionet.biophysics,bionet.general,bionet.info-theory,bionet.molbio.bio-matrix,bionet.molbio.evolution,bionet.molbio.proteins,bionet.molec-model,bionet.software,bionet.women-in-bio,bionet.xtallography Subject: PSB '97 Travel Support Announcement Date: 30 Oct 1996 16:46:17 -0800 Organization: National Library of Medicine Lines: 42 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Xref: biosci bionet.biophysics:2386 bionet.general:23826 bionet.info-theory:4351 bionet.molbio.bio-matrix:777 bionet.molbio.evolution:5261 bionet.molbio.proteins:9164 bionet.molec-model:1216 bionet.software:16967 bionet.women-in-bio:5623 bionet.xtallography:2986 >> TRAVEL SUPPORT ANNOUNCEMENT << Pacific Symposium on Biocomputing Jan 6-9, 1997 Kapalua, Maui, Hawaii The Pacific Symposium on Biocomputing (PSB-97) is an international, multidisciplinary conference for the presentation and discussion of current research in the theory and application of computational methods in problems of biological significance. A recent grant has made more travel award money available for PSB97. Significant support is available for qualified applicants. Preference will be given to women and minority applicants, as well as to those from academic or non-profit institutions. The awards will be balanced to ensure adequate participation of young faculty, students and post-docs, and to ensure good geographic and institutional distribution. Finally, consideration will be given to the needs of the session chairs in their efforts balance the content and improve the quality of the presentations in their respective domains. Time is of the essence! You must submit your request for support by November 1, 1996. You must also register for the conference and make your hotel reservations by that date, as the hotel will no longer hold rooms for the conference and the early conference registration rate ends on Nov. 1. Please see our web page at http://www.cgl.ucsf.edu/psb for more information. -- Lawrence Hunter, PhD. National Library of Medicine phone: +1 (301) 496-9303 Bldg. 38A, 9th fl, MS-54 fax: +1 (301) 496-0673 Bethesda. MD 20894 USA email: hunter@nlm.nih.gov From owner-biophysics@net.bio.net Wed Oct 30 22:00:00 1996 Path: biosci!bcm.tmc.edu!cs.utexas.edu!swrinde!howland.erols.net!EU.net!Austria.EU.net!01-newsfeed.univie.ac.at!swidir.switch.ch!swsbe6.switch.ch!news.belnet.be!news.sri.ucl.ac.be!usenet From: Claude DROSSART Newsgroups: bionet.biophysics Subject: ESOR VI Date: Wed, 30 Oct 1996 15:36:29 -0800 Organization: universite catholique de Louvain Lines: 236 Distribution: world Message-ID: <3277E67D.6FDF@cico.ucl.ac.be> Reply-To: chop@cico.ucl.ac.be NNTP-Posting-Host: 130.104.14.41 Mime-Version: 1.0 Content-Type: multipart/mixed; boundary="------------33CD2D9E28B8" X-Mailer: Mozilla 3.0 (Win16; I) This is a multi-part message in MIME format. --------------33CD2D9E28B8 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit -- Avec les meilleurs sentiments du laboratoire Chop, Universite catholique de Louvain-CICO-Chop 1, place Pasteur, 1348-Louvain la Neuve (Wallonie-Belgique) tel: 32-10-472713/ fax: 32-10-473074 --------------33CD2D9E28B8 Content-Type: text/plain; charset=us-ascii; name="ESOR1CIR.TXT" Content-Transfer-Encoding: 7bit Content-Disposition: inline; filename="ESOR1CIR.TXT" Notes:- This message is being sent to multiple lists; my apologies if you receive it more than once. - We attach the greatest value to Exhibit and Sponsorship opportunities. ESOR-VI 6th European Symposium on Organic reactivity Louvain-la-Neuve 24 - 29 July 1997 _______________________________________First Circular The Catholic University of Louvain, located in the Belgian city of Louvain-la-Neuve, will host the next conference entitled "European Symposium on Organic Reactivity". This will be the sixth edition of a series of successful meetings held in Paris (1987), Padova (1989), Göteborg (1991), Newcastle-upon-Tyne (1993) and Santiago de Compostela (1995). The conference will be held during the period Thursday 24 to Tuesday 29 July 1997. The scientific sessions will start on Thursday afternoon and the meeting will end at lunchtime on Tuesday. Location ________ Louvain-la-Neuve is located about 30 km South of Brussels in the french-speaking part of Belgium. The city is connected with Brussels by rail and is readily accessible by road (Motorway E411) from everywhere in Europe. Brussels National Airport is linked to all major and most medium-size European cities. The Conference site will be part of the academic facilities of the Catholic University of Louvain (U.C.L.). This University was founded in the old Belgian city of Leuven in 1425 as one of the oldest universities in Europe. In the early 1970's, the french-speaking part of the University moved to a completely new city which was called Louvain-la-Neuve, on the territory of a town named Ottignies. The University population amounts to more than 20,000 students. Courses are organized in all disciplines of human knowledge by ten Faculties : Theology, Philosophy, Law, Economic and Social Sciences, Philology and Arts, Psychology and Educational Sciences, Sciences, Applied Sciences, Medicine and Agronomy. Scientific Programme ____________________ The meeting will be devoted to all aspects of physical organic chemistry. The conference programme will focus on three main topics : 1. Mechanisms and reactivity in organic, bioorganic and organometallic chemistry, including theoretical approaches 2. Photochemical and electron transfer activation processes 3. Molecular recognition and enzyme mechanism. The programme will include 12 plenary lectures, two parallel sessions with their own invited lectures. A limited number of oral presentations will be selected among the submitted contributions. Two separate poster sessions are planned on Friday afternoon and Monday afternoon with comfortable discussion times. Persons wishing to present an oral or poster contribution should submit a one-page abstract according to the format detailed below not later than February 15, 1997 and send it to Prof. M. Devillers ESOR-VI Conference Secretary Catholic University of Louvain Laboratory of Inorganic and Analytical Chemistry 1 place Louis Pasteur B-1348 Louvain-la-Neuve , Belgium Tel. : 32-10 47 28 27 Fax : 32-10 47 28 36 e-mail : devillers@inan.ucl.ac.be Plenary lectures ________________ Twelve recognized experts have already agreed to give Plenary Lectures on the following topics : V. Balzani,University of Bologna, Italy, Supramolecular photochemistry. S.J. Benkovic,The Pennsylvania State University, USA, Perspective on biocatalysis. F. Diederich,Swiss Federal Institute of Technology, Zurich, From supramolecular chemistry to medicinal chemistry. J.B. Engberts,University of Groningen, The Netherlands, Vesicles formed from synthetic amphiphiles. Fusogenic behavior and applications as drug carrier systems. J. Fréchet,Cornell University, USA, Designing for novel macromolecular architectures:from concept to applications. B.Giese,University of Basel, Switzerland, Reactivity of DNA radicals. Y. Kishi,Harvard University, USA, Synthetic studies in the field of natural product chemistry. H. Mayr,Technische Hochschule Darmstadt, Germany, Linear free enthalpy relationship : a powerful tool for the design of organic or organometallic syntheses. R. Noyori,Nagoya University, Japan, Asymmetric hydrogenation : mechanistic aspects. M. Poliakoff,University of Nottingham, U.K., Intermediates in organometallic chemistry. P. von Rague Schleyer,University of Erlangen-Nürnberg, Germany, Organic reactivity and computational chemistry. I. Willner,The Hebrew University of Jerusalem, Israel, Electroenzymes, photoenzymes and command surfaces - Tailored assemblies for optobioelectronic devices. Abstracts _________ Full one-page abstracts will be reproduced directly from authors'original documents. They should be typed or printed in English using double line spacing on A4 formatted white paper. The whole of the abstract must be contained within a rectangle of size 242 x 165 mm. It will be reduced to 79 %. The headings should be presented in the format given below, including the full line separating text and heading. References should be indicated within square brackets in the text and listed at the bottom of the abstract using standard Chemical Abstracts Source Service Index terminology followed by volume,(year within brackets) , first page. Example: DECOMPOSITION OF NITROSOUREAS IN THE PRESENCE OF DIFFERENT NUCLEOPHILES S. Amado*, A. Andrade, L. Garcia-Rio, J.R. Leis and A.M. Rios, Departamento de Quimica Fisica, Facultad de Quimica, Universidad de Santiago, 15706 Santiago de Compostela, Spain. The reactivity of different nucleophiles toward the ambident electrophile N-nitroso-N,N'-dimethylurea (NDMU) has been investigated. The experimental results... The Book of Abstracts including all lectures and oral or poster contributions will be handed out to all registered participants upon arrival. Social Events _____________ The provisional social programme for Conference participants includes the following events : Thursday : Welcome drink and get-together sandwich buffet at lunchtime Thursday evening : Concert Friday evening : Belgian Cheese and Beer party at the end of the poster session Sunday afternoon : Excursion Monday evening : Conference Dinner An Accompanying Persons' Programme will be arranged for the whole conference period. Further details will be included in the Second Circular. Registration fees _________________ -Normal pre-registration fee before March 31, 1997 BEF 10 000 Registration fee after March 31, 1997 BEF 12 500 -Students before March 31, 1997 BEF 5 000 after March 31, 1997 BEF 6 000 -Participants from Industry before March 31, 1997 BEF 15 000 after March 31, 1997 BEF 18 000 -Accompanying Persons BEF 2 000 Organizing Committees _____________________ Local Organizing committee -------------------------- Chairmen :Prof. J. Fastrez and Prof. L. Ghosez (U.C.L., Louvain-la-Neuve) Conference Secretary :Prof. M. Devillers (U.C.L., Louvain-la-Neuve) Members : Dr. O. B Nagy (U.C.L., Louvain-la-Neuve) Prof. P. De Clercq (R.U.G., Gent) Prof. F. De Schrijver (K.U.L., Leuven) Prof. L. Hevesi, (F.U.N.D.P., Namur) Prof. F. Kirsch-Demesmaeker (U.L.B., Brussels) Prof. A. Laschewsky (U.C.L., Louvain-la-Neuve) Prof. J. Marchand-Brynaert (U.C.L., Louvain-la-Neuve) Prof. J.-P. Soumillion (U.C.L., Louvain-la-Neuve) International Advisory Committee -------------------------------- Prof. P. Ahlberg (Chairman, Göteborg, Sweden) Dr. M. Eckert-Maksic (Zagreb, Croatia) Prof. J. Engberts (Groningen, Netherlands) Dr. R. Leis (Santiago de Compostela, Spain) Dr. H. Maskill (Newcastle-upon-Tyne, England) Prof. R. More O'Ferrall (Dublin, Ireland) Prof. P. Müller (Genève, Switzerland) Prof. M. Page (Huddersfield, England) Prof. Z. Rappoport (Jerusalem, Israel) Prof. M.-F. Ruasse (Paris, France) Prof. G. Scorrano (Padova, Italy) Prof. U. Siehl (Ulm, Germany) For further information, please refer to the Scientific Secretariat of the Conference : Prof. M. Devillers ESOR-VI Conference Secretary Catholic University of Louvain Laboratory of Inorganic and Analytical Chemistry 1 place Louis Pasteur B-1348 Louvain-la-Neuve , Belgium Tel. : 32-10 47 28 27 Fax : 32-10 47 28 36 e-mail : devillers@inan.ucl.ac.be or get a moment to see our page maintained by Claude Drossart at: http://www.chim.ucl.ac.be/CHIM/esor.html To receive the Second Circular/Application Form for this Symposium (January 1997), please print and fill in the following form, send it to the Conference Secretary ( or an Email with the same information). DO NOT SEND YOUR REPLY TO THE LIST ! _______________________________________________________________ Title : Prof. - Dr. - Mr. - Mrs. (circle when applicable) Name : ____________________________________________________________ First Name : ____________________________________________________________ Institution : ____________________________________________________________ Address : ____________________________________________________________ ____________________________________________________________ ____________________________________________________________ ____________________________________________________________ tel:_________________ fax:_____________________ e-mail:__________________________________________ I intend to present a short contribution preferably as oral presentation preferably as a poster I have no preference between oral and poster presentation --------------33CD2D9E28B8-- From owner-biophysics@net.bio.net Wed Oct 30 22:00:00 1996 Path: biosci!daresbury!not-for-mail From: Alexy Eroshkin Newsgroups: bionet.biophysics Subject: ProAnWin - Protein Analyst for Windows available at IUBio archive Date: 31 Oct 1996 11:16:31 -0000 Organization: State Research Center of Virology & Biotechnology VECTOR Lines: 37 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <55a1qf$ihv@mserv1.dl.ac.uk> Original-To: biophys@dl.ac.uk Our recent program ProAnWin, Protein Analyst for Windows 3.11/95, is now available at iubio.bio.indiana.edu, in directory /molbio/ibmpc/ as paw.exe. Access to iubio by ftp, http, and gopher methods are supported. ProAnWin is an application for multiple protein sequence alignment (automatic and manual), comparative sequence analysis, studying protein structure-activity (genotype - phenotype) relationships and designing site-directed mutagenesis (with 3D structire viewer). The program does: input of sequences from several formats (SWISS-PROT, PIR, FASTA, GCG, CLUSTAL) and 3D structure in PDB format; flexible multiple protein sequences alignment and threading sequences into known 3D structure (ClustalV + manual alignment); input of user-defined protein activities, properties or related phenotypes (with possibility to transform activity: log(x), 1/x, etc.); calculation of many characteristics (hydrophobicity, amphipathicity, etc.) of linear and spatial protein sites; fast multiple linear regression analysis of structure-activity relationships (up to eight independent factors); activity prediction for untested or mutated proteins; data visualization (regression plots, 3D structures with sites highlighted, multiple alignments); displaying found sites on sequences and 3D structure. The program can be applied to analysis of various protein-related biological data, to prediction of activity (phenotype) of newly sequenced proteins and to simulation of protein-engineering experiments. ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ Alexey Eroshkin Research Institute of Molecular Biology E.mail: eroshkin@vector.nsk.su State Research Center of Virology and Tel: +7 (3832) - 647774 Biotechnology "Vector" Fax: +7 (3832) - 328831 Koltsovo, Novosibirsk Region 633159 Russia +++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++