From owner-embldatabank@net.bio.net Fri Jul 01 23:00:00 1994
Newsgroups: bionet.molbio.embldatabank
Path: biosci!galaxy.ucr.edu!ihnp4.ucsd.edu!agate!doc.ic.ac.uk!daresbury!trane.uninett.no!eunet.no!nuug!EU.net!uunet!newsgate.watson.ibm.com!hawnews.watson.ibm.com!puffin!dflash
From: dflash@watson.ibm.com (The dFLASH Project)
Subject: Announcing GENBANK and PIR search engine (The dFLASH server)
Sender: news@hawnews.watson.ibm.com (NNTP News Poster)
Message-ID: <Cs39u9.u5r@hawnews.watson.ibm.com>
Date: Tue, 28 Jun 1994 04:01:21 GMT
Disclaimer: This posting represents the poster's views, not necessarily those of IBM.
Nntp-Posting-Host: puffin.watson.ibm.com
Organization: IBM T.J. Watson Research
Lines: 417



The dFLASH Group announces the release of a new electronic mail server that
allows GENBANK and PIR similarity searches with the FLASH algorithm.  The 
server is accessible through the internet and is now operating 24 hours a
day, 7 days a week.  Appended, you will find the new server's help file.

Sincerely,

The dFLASH Group





------------------------------>  CUT HERE <-----------------------------------


!!  ====================    MESSAGE OF THE DAY   ==========================  !!
!!                                                                           !!
!!  June     14, 1994:   We are now supporting both GENBANK  &  PIR searches !!
!!                       Releases:  PIR 40      (no incremental updates)     !!
!!                              &   GENBANK 82  (no incremental updates)     !!
!!  June     12, 1994:   The VERBOSE directive now works correctly.          !!
!!  November 16, 1993:   Beginning today, *NO* registration is required      !!
!!                       in order to use the dflash server.                  !!
!!                                                                           !!
!!  ====================    MESSAGE OF THE DAY   ==========================  !!


!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
!!                                                                           !!
!!                         N O T A     B E N E                               !!
!! The dFLASH server is still under development.  If some of the answers do  !!
!! not make sense it is very likely that this is due to a bug in our code.   !!
!! Please, help us improve this service  by reporting such bugs:  you can    !!
!! email bug reports and comments to dflash@watson.ibm.com with subject line !!
!! "bug" or "comments".                                                      !!
!!                                                                           !!
!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

    Dear User, welcome to the dFLASH server!

    The dFLASH server is a "homologous sequence retrieval" program for PROTEIN
and DNA sequences.  We currently support the following databases:

    PIR     -- Release 40 with *no* incremental updates. 
       For more information, contact:  Protein Information Resource (PIR),
       National Biomedical Research Foundation 3900 Reservoir Road, N.W.,
       Washington, DC  20007, USA

    GenBank -- Release 82 with *no* incremental updates
       For more information, contact:  National Center for Biotechnology
       Information National Library of Medicine, 38A -- 8N805, 8600 Rockville
       Pike Bethesda, MD  20894,  USA


    dFLASH is a parallel system running on a prototype 16-node IBM SP/1. 
Intra-node communication, evidence integration and alignment are performed in
parallel and use a prototype interconnection network.  The currently observed
performance is estimated to be between 2 and 5 times slower than that of a
production line SP/1.  The system has been implemented using IBM's Concert/C
language for distributed programming. The server is now available 24 hours a
day, 7 days a week.  Backups are perfomed daily between 01:00 and 01:30 Eastern
Standard Time, so performance is likely to be affected during this period.  At
the moment we automatically alternate service between the GenBank and PIR 
servers and thus certain lag may be observed:  this will be alleviated in
future releases of the server code.

    Incremental changes and improvements made to the server will be reflected
in the "Message of the day" at the beginning of this help file:  we recommend
that users periodically issue a `send help' request for up to date information
on the server.

    For the moment, we can process requests originating from email addresses of 
the form 
                 user@[machine.][subdomain.]institution.type
                        or 
                 user%machine@[machine.][subdomain.]institution.type
                        or 
                 "string::user"@[machine.][subdomain.]institution.type

We plan to further expand the accepted formats, depending on demand.


$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$

HOW TO USE THE SERVER: You can use the dFLASH facilities by sending an email 
---------------------- message with the appropriate syntax to the address 
		       "dflash@watson.ibm.com" (without the quotes).
			
SUBJECT LINE: It is important that the "Subject" line of your message contain 
------------- one of: { dflash, dFlash, dFLASH, DFLASH }.  Messages whose
              subject line does NOT conform to this rule, **WILL BE LEFT
	      UNPROCESSED**.  The reason for that restriction is that we want
	      to be able to automatically distinguish between messages that are
	      addressed to the server and those that are meant for one  of the
	      group members.

$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$


MESSAGE FORMAT: The typical message-body of an email request looks as follows
---------------

     BLOSUM 250                                 (optional  | DIRECTIVE)
     VERBOSE  10 20                             (optional  | DIRECTIVE)
     SEQUENCES  100                             (optional  | DIRECTIVE)
     ALIGNMENTS 50                              (optional  | DIRECTIVE)
     THRESHOLD  30                              (optional  | DIRECTIVE)
     TARGET PROTEIN                             (optional  | DIRECTIVE)
     BEGIN                                      (mandatory | DIRECTIVE)
     >A_ONE_LINE_TEST_SEQ_LABEL                 (mandatory -- notice the '>' )
     a_sequence_of_{amino_acids,spaces,tabs}
     1                                          (mandatory terminator)

    The PAM/BLOSUM, VERBOSE, SEQUENCES, ALIGNMENTS, THRESHOLD, and TARGET
directives can appear in any order but they *must* precede the BEGIN directive. 
The BEGIN line must be followed by the LABEL line which in turn should be
followed by the test sequence.

    The test sequence should contain at least 30 and not more than 3,000 amino
acid or nucleotide characters.  But it may contain ANY NUMBER of CARRIAGE RETURN
TAB and SPACE characters; the latter are not of course counted while computing
the length of the test sequence. There is NO case sensitivity in the label and
the test sequence itself.

    The words appearing on the lines marked DIRECTIVE above can be in lower
case or upper case; in other words, you can have pam or PAM, threshold or
THRESHOLD, alignments or ALIGNMENTS, etc.  However, something like ThReShOlD
will not work.

    The directive pertaining to the scoring matrix allows the user to specify
the matrix to be used for computing the alignment scores.  You can use either
the word PAM followed by a space and the desired distance, or the word BLOSUM
followed by space and the desired distance.  Examples:  PAM 250, BLOSUM 62 etc.
If no matrix directive is included in the message, PAM 250 is used as the
default.  Depending on the values of the directive TARGET (see below) the
matrix directive if present may be ignored.

    The VERBOSE line allows the sender to also retrieve the data about authors,
dates, entries, superfamilies etc. that are contained in the original PIR and
GenBank databases.  This directive accepts one OR two arguments; for example:
                verbose         15      25
means "send me the text data for the sequences occupying positions 15 through 25
in the final ranking."  On the other hand,
                verbose         15
means "send me the text data for the sequences occupying the first 15 positions
in the final ranking."  If no verbose line appears, no citation data is sent.

    The SEQUENCES line allows one to restrict the reported sequences to the
given number.  This directive controls the number of entries in the ``short
list'' of recovered database sequences only.  If no SEQUENCES line is given,
the server code will set it to an appropriate default value.

    The ALIGNMENTS line allows one to restrict the reported alignments to the
given number.  If no ALIGNMENTS line is given, the server code will set it to
an appropriate default value.  The ALIGNMENTS value cannot exceed 1000.  Values
larger than 1000 are reduced to 1000.

    The THRESHOLD line allows one to restrict the number of reported sequences
(and thus alignments) to only those whose Score exceeds the given THRESHOLD
value.  If no THRESHOLD line is given the server code will set it to an
appropriate default value.  The default values are 50 for DNA sequences, and 80
for PROTEIN sequences.   There is also a *hard* threshold value of 20 for DNA,
and 30 for PROTEIN sequences;  if the user-requested values are smaller than
these hard-thresholds, the requested threshold will be increased accordingly.
NOTA BENE:  (1) if the THRESHOLD value is too small, you are running the danger
---------   of upsetting your mailer program since chances are that you will
            receive a very big file as a reply from the server.  
	    (2) if the THRESHOLD is too high the list of recovered entries 
	    will be empty, or very short; you should decrease the threshold's
	    value and resubmit your query.

    The TARGET line allows the user to specify the type of the target database,
as being one of { PROTEIN , DNA }.  This way the user controls the database in
which the search will be carried out.  If TARGET is set to PROTEIN, the search
will take place in the PIR database.  If TARGET is set to DNA, the search will
take place in the GenBank database.    We will soon allow users to 'mix and
match.'  I.e. the users will be able to request that amino acid sequences
be searched againt GenBank, nucleotide sequences against PIR etc. by making use
of the appropriate directives. If no TARGET line is given, the server will
assume the default value PROTEIN and thus will search against the PIR database.

    The LABEL line allows the user to enter mnemonic information pertaining the
the test sequence, the time of the day etc.  The information of this line will
be reproduced in the Subject line of the reply message.   Notice that the
LABEL line *must* begin with the character '>'.

    All the submitted messages must be terminated by the number '1'  This
number can follow the last character of the test sequence or be in a line by
itself.


$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$


EXAMPLES:  Two example inputs follow
---------

Example 1: 
                pam 250
                sequences 50
                alignments 30
                threshold  100
		target protein
                begin
                > HBA_HUMAN STANDARD; PRT; 141 AA. P01922; HEMOGLOBIN ALPHA 
                VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFP
                TTKTYFPHFDLSHGSAQVKGHG     KKVADALTNA
                V A H V D D M PNALSALSDLHAHKLRVDPVNFK
                llshcllvtlaahlpaeftpavhasldkflasvstvltskyr
                1

            Note:  all amino acids  from "VLSP" through "ltskyr  will be used 
            in the search.  Not more than the 50 top scoring sequences will be
            reported in the short list.  Also, the alignments for the top 30
            scoring sequences will be returned.  No reported sequence will have
            score that is less than 100.  The test sequence is declared to be a
	    sequence of amino acids and should be searched against the PIR
	    database.

Example 2:
                BLOSUM 62
                BEGIN
                > Sequence sent to dflash on Fri May 20 13:40:17 EDT 1994
                VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFP
                TTKTYFPHFDLSHGSAQVKGHG     KKVADALTNA

                V A H V D D M PNALSALSDLHAHKLRVDPVNFK

                llshcllvtlaahlpaeftpavhasldkflasvstvltskyr
                1

            Note:  all amino acids  from "VLSP" through "ltskyr"  will be used 
            in the search.  The server code will set the various parameters to
            appropriate default values.  The server will treat the test sequence
	    as a sequence of amino acids (default) and will search against the 
	    PIR database (default) with a score threshold set at 80 (default).


$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$

SCORING MATRICES:
-----------------

    You can use both PAM and BLOSUM scoring matrices for protein searches. These
can be requested via the optional { pam, PAM, blosum, BLOSUM } directive. The
currently supported distances are

for BLOSUM:  30, 35, 40, 45, 50, 55, 60, 62, 65, 70, 75, 80, 85, 90, 100

for PAM:     10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150,
             160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280,
             290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410,
             420, 430, 440, 450, 460, 470, 480, 490, and 500.

For DNA searches, the PAM/BLOSUM declarations are ignored


$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$


NOTE ON ALIGNMENT:
------------------

    The server's alignment code implements the Smith-Waterman algorithm (dynamic
programming) to align each of the retrieved sequences with the test input. This
is *NOT* to be confused with the indexing method that we use to determine the
candidates to be aligned.

    The meaning of the variables in the listing that is returned by the dFLASH
server 

    .....
    ....

    Score Matrix: PAM250
    Max Reported Sequences:  1000
    Max Reported Alignments: 10
    Score Threshold  At: 65

     Id  Label:                                   Score  NRes  Ex% Tot% Sig  Pk
    ----------------------------------------------------------------------------
      1. HAHU hemoglobin alpha chain - human        655   141 100% 100% 100  89
      2. HACZ hemoglobin alpha chain - chimpanzee   655   141 100% 100% 100  89
      3. HACZP hemoglobin alpha chain - pygmy chi   655   141 100% 100% 100  89
      4. HAGO hemoglobin alpha chain - lowland go   654   141  99% 100%  99  89
      5. HAMQP hemoglobin alpha chain - hanuman l   653   141  97% 100%  99  89
      6. B27792 hemoglobin alpha-1 chain - orangu   649   141  97% 100%  99  89
      7. A25126 hemoglobin alpha-1 chain - Sumatr   649   141  97% 100%  99  89
     ...
     .....
     ..

is the following:

NRes:  the number of residues (amino acids) in the recovered match
Score: sequence  similarity score of the recovered sequence based on the
       selected mutation matrix
Ex%:   percentage of *exact* matching residues
Tot%:  percentage of *total* (=exact+conservative) matching residues
Sig:   100 times the ratio between the actual computed score and the score
       obtained by matching the retrieved sub-segment with itself; the
       denominator is the maximum obtainable score for the sub-segment in
       question (all gaps removed).
Peak:  the maximum score value over *any* 20 residue-window of the recovered
       match


$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$


TO OBTAIN HELP:
---------------
    You can obtain this message at any moment by sending a message with one of:
{ dflash, dFlash, dFLASH, DFLASH } in the "Subject" line and a body containing
one of { help, HELP, send help, SEND HELP }.


$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$


TO OBTAIN ON-LINE REPRINTS OF PAPERS
------------------------------------
    You can obtain reprints (in PostScript) of relevant papers by sending a
message with one of: { dflash, dFlash, dFLASH, DFLASH } in the "Subject" line
and a body containing 

one of {flashpaper, FLASHPAPER, send flashpaper, SEND FLASHPAPER }        
                                        ---> returns to the originator of the 
                                        request a copy of the FLASH paper

one of {dflashpaper, DFLASHPAPER, send dflashpaper, SEND DFLASHPAPER }        
                                        ---> returns to the originator of the 
                                        request a copy of a paper that contains
                                        a description of dFLASH (long)

one of {concertpaper, CONCERTPAPER, send concertpaper, SEND CONCERTPAPER } 
                                        ---> returns to the originator of the 
                                        request a copy of a high-level paper
                                        describing the CONCERT/C language

one of {bayespaper, BAYESPAPER, send bayespaper, SEND BAYESPAPER } 
                                        --> returns to the originator of the 
                                        request a copy of a paper describing 
                                        a computer-vision application based 
                                        on similar to dFLASH indexing 
                                        principles (long)

    Notice there can only be *one* such request per message! Also, make sure
you do not issue a new paper request until after the previous request has
returned to you all of the postscript files and you have removed the latter
from your mailbox:  the returned messages are rather big (between 1 and 4
Megabytes) and are guaranteed to overflow the disk set aside for mail messages
on most systems.


$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$


OTHER  NOTES:
-------------

(1) for the time being we do not incorporate incremental updates of PIR
(2) for the time being we do not incorporate incremental updates of GenBank
(3) dFLASH searches are currently available through GRAIL of the Oak Ridge
    National Laboratory.

Thank you for your interest in the dFLASH server. 

                                        Sincerely,

                                        The dFLASH Group


$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$

COMMENTS??  We will appreciate receiving your feedback, suggestions, comments, 
----------  or bug reports; all of these can be sent to "dflash@watson.ibm.com" 
	    Please, make sure your  "Subject" line contains the word "comments"
	    or "bug".

$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$

REFERENCES  If you make use of the dFLASH server, please reference 
----------

     A. Califano and I. Rigoutsos, "FLASH: A Fast Look-up Algorithm for String
     Homology."  In Proceedings of the First International Conference on
     Intelligent Systems for Molecular Biology, July 1993, Bethesda, MD.

     I. Rigoutsos and A. Califano, "Searching In Parallel for Similar Protein
     Strings."  In IEEE Computational Science and Engineering, June 1994.

If you wish to find out more, you can contact Isidore Rigoutsos and Andrea
Califano at {rigoutso,acal}@watson.ibm.com


$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$


For more information on the Concert/C language, please refer to

     J. Auerbach, D. Bacon, A. Goldberg, G. Goldszmidt, A. Gopal, M. Kennedy,
     A. Lowry, J. Russell, W. Silverman, R. Strom, D. Yellin, and S. Yemini,
     "High-level language support  for programming reliable distributed
     systems."  In Proceedings of the International Conference on Computer
     Languages, April 1992, Oakland, California.

or contact Jim Russell (jrussell@watson.ibm.com)

$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$


------------------------------>  CUT HERE <-----------------------------------


From owner-embldatabank@net.bio.net Thu Jul 07 23:00:00 1994
Path: biosci!biosci!not-for-mail
From: stoehr@embl-heidelberg.de (Peter Stoehr)
Newsgroups: bionet.molbio.embldatabank,embnet.general,bionet.announce
Subject: Press Release: EBI Senior Appointments
Date: 8 Jul 1994 15:51:44 -0700
Organization: European Molecular Biology Laboratory
Lines: 66
Sender: kristoff@net.bio.net
Approved: bionews-moderator@net.bio.net
Distribution: bionet
Message-ID: <1994Jul8.184230.171400@eros.embl-heidelberg.de>
NNTP-Posting-Host: net.bio.net
Xref: biosci bionet.molbio.embldatabank:349 bionet.announce:1271


              The European Bioinformatics Institute (EBI)
                          Senior  Appointments
                           EMBL Press Release
                        Heidelberg, 4 July 1994


A  compelling  package  of   senior   appointments   to   the   European
Bioinformatics Institute (EBI), proposed unanimously by an international
selection committee of experts, was ratified last week by the Council of
the  European  Molecular  Biology  Laboratory.   The  EBI  is the newest
Outstation  of  EMBL,  an  international  research  institute  with  its
headquarters in Heidelberg, Germany.

The new appointments are designed to provide strong  management  of  the
EBI  and  a  high quality nucleus for the research division.  The latter
will complement and closely interact with the service branch of the  EBI
led  by  Graham  Cameron, under whose leadership the EMBL Data Library -
the starting point for the EBI  and  its  continuing  first  priority  -
gained international acclaim.

The Head of EBI will be Paolo Zanella,  Professor  of  Architecture  and
Technologies  of Computers at the University of Geneva.  He is currently
on leave from CERN where he built up a Data Handling Division  with  300
staff  over  15  years.   Since  1990  he has also been a founder, Chief
Executive Officer and Scientific Director of CRS4 in Cagliari, Sardinia,
a  centre  for high-performance computers and networks.  Thus, he brings
to  the  EBI  expertise  and  vision  for  future  developments  in  the
applications   of   informatics,  and  a  highly  successful  record  in
establishing and managing major service and R & D centres.

The Coordinator of Research (50% time)  will  be  Michael  Ashburner,  a
renowned  geneticist  and  Professor at the University of Cambridge, who
has also made major contributions to the development  of  bioinformatics
resources.   Currently he leads the only European group participating in
the NIH-funded development  of  "FlyBase",  an  integrated  resource  of
genetic, molecular and bibliographic data on Drosophila.

The first two Group Leader appointments in the  research  division  have
been  offered  to  Dr.   Chris Sander, currently at EMBL Heidelberg, and
Prof.  Shoshana Wodak, currently at Universite Libre de Bruxelles.  They
are  among the best known European scientists working in the broad field
of sequence/structure relationship of proteins.

These appointments give confidence that the EBI will establish itself as
a  centre  of excellence and reference world-wide in scientific database
management, methodology and development, and in bioinformatics research.
It will provide informatics support for European academic and industrial
research in biology  and  biotechnology,  in  close  collaboration  with
EMBnet  and  other  essential  and independent bioinformatics activities
throughout Europe.

The EBI will be located on the Hinxton Hall site, south of Cambridge  in
the  UK,  which  is  owned by the Wellcome Trust.  The EMBL Data Library
will move to that site in September 1994, beginning the operation of the
EBI.   The site already hosts the Sanger Centre directed by J.  Sulston,
which specialises in genome-scale sequencing, and will also be  the  new
home  of the UK Medical Research Council's Human Genome Project Resource
Centre, directed by K.  Gibson.

On announcing the recent appointments, F.   C.   Kafatos,  the  Director
General  of  EMBL,  acknowledged  the  financial support of the European
Union for the EMBL Data Library,  the  substantial  investments  of  the
Wellcome  Trust  and  the MRC for launching the EBI, and the continuing,
long term support of the EMBL member states that will allow the  EBI  to
serve science well.

