From owner-embldatabank@net.bio.net Sun Dec 03 22:00:00 1995 Newsgroups: bionet.molbio.embldatabank Path: biosci!bcm.tmc.edu!news.msfc.nasa.gov!newsfeed.internetmci.com!howland.reston.ans.net!EU.net!Germany.EU.net!news.dfn.de!news.embl-heidelberg.de!bioftp.unibas.ch!daresbury!hgmp.mrc.ac.uk!ebi.ac.uk!EMBL-EBI.ac.uk!stoesser From: stoesser@EMBL-EBI.ac.uk (Guenther Stoesser) Subject: Feature Table Definition Document v1.08 Sender: news@ebi.ac.uk (Mr news) Message-ID: Date: Mon, 4 Dec 1995 12:55:39 GMT Lines: 33 Reply-To: stoesser@EMBL-EBI.ac.uk (Guenther Stoesser) Organization: European Bioinformatics Institute (EMBL) - UK X-Newsreader: mxrn 6.18-32 Dear Colleagues, this is to announce that the DDBJ/EMBL/GenBank Feature Table Definition Document v1.08 has been created. The new version of this document is available by anonymous FTP as a compressed tar-file with postscript parts from the European Bioinformatics Institute (EBI) in Cambridge, UK. FTP server at EBI: ------------------ Users should connect via anonynous FTP to FTP.EBI.AC.UK Directory: pub/databases/embl/doc File: FTv1.08.tar.Z WWW server at EBI: ------------------ The document is also available on the EBI WWW-server in URL: http://www.ebi.ac.uk/ebi_docs/embl_db/ft/feature_table.html I would like to thank colleagues at DDBJ and NCBI for their feedback in the process of producing this document. Regards, Guenter Stoesser Guenter Stoesser E-mail: stoesser@ebi.ac.uk European Bioinformatics Institute URL: http://www.ebi.ac.uk Hinxton Hall, Hinxton, Telephone: +44 (0)1223 494 466 Cambridge CB10 1RQ U.K. Fax: +44 (0)1223 494 468 From owner-embldatabank@net.bio.net Tue Dec 05 22:00:00 1995 Path: biosci!internet!biosci!not-for-mail From: biohelp (BIOSCI Administrator) Newsgroups: bionet.molbio.embldatabank Subject: IMPORTANT: BIOSCI miniFAQ Date: 6 Dec 1995 02:02:47 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 196 Sender: daemon@net.bio.net Distribution: world Message-ID: <199512061000.CAA16980@net.bio.net> NNTP-Posting-Host: net.bio.net This is a new "miniFAQ" designed to answer the questions that come up the *most frequently*. The main BIOSCI FAQ (Frequently Asked Questions) is accessible on the World Wide Web at URL http://www.bio.net/. Contents: -------- 1) What to do about "spams," i.e., junk mail, ads, etc. 2) Examples of subscribing and unsubscribing to the mailing lists. 3) How to access BIOSCI/bionet newsgroup archives. 4) The BIOSCI user address and research interest directory. 1) What to do about "spams," i.e., junk mail, ads, etc. ------------------------------------------------------- BIOSCI is a set of parallel USENET newsgroups (the "bionet" groups) and mailing lists. The same postings are distributed on both media (except for a small number of mailing-list-only groups at net.bio.net). Unfortunately it is becoming a despicable practice on the Internet (by a few people out to make a fast buck) to do automated mass postings to thousands of newsgroups and mailing lists. These attempts to grab free advertising are refered to as "spams" in the usual, somewhat boneheaded, net terminology. USENET is more susceptible to this practice, and many spams originate on the USENET groups and then are passed on to the mailing lists. However, spammers also get lists of mailing addresses and hit these too, so neither medium is immune. What should you do personally if you get junk mail? --------------------------------------------------- Just delete it and move on without reading it further. Filing a protest is becoming increasingly useless because spammers are often disguising the addresses where the messages are sent from. Unless you really understand Internet mail systems, your attempt at protest by sending replies to the message will often end up being sent to the address of an innocent person that the spammer is victimizing. What can BIOSCI/bionet do to protect its newsgroups? ---------------------------------------------------- The only solution currently available is to moderate the newsgroup. If this newsgroup is already moderated, then you are in good shape. Moderation protects the newsgroups from about 95% of the spams that are being sent to date. This means that someone has to take the time to review each message before it goes out. We have set up software here that simply allows the moderator to forward to an address at net.bio.net messages that (s)he wishes to have distributed. This takes no more time than that needed to read the message and pass it on, say about 1 min. per message. Most newsgroups currently have a discussion leader who is responsible for their newsgroup. The discussions leaders and their e-mail addresses are listed in the BIOSCI Information Sheet which is available on the Web at http://www.bio.net/. If a newsgroup is being hit with too many junk postings, please contact the discussion leader for that group and see if there is interest in moderating the group. Please do not assume that by simply posting a complaint to the newsgroup itself, anyone on the BIOSCI staff will act on your complaint. With close to 100 newsgroups to run, the BIOSCI staff has to rely on the discussion leaders of each newsgroup to report problems directly to us at biosci-help@net.bio.net. We will moderate any of our newsgroups if the discussion leader tells us that the readership of the group wishes to do so and if a moderator is willing to do the work. For most BIOSCI/bionet groups, this entails only a few minutes of work each day. Moderating a newsgroup will resolve probably 95% of the junk postings. Unfortunately there are easy ways for determined spammers to override the moderation mechanism. We are working on new systems to provide access to our newsgroups over the WWW. These should be available soon, probably November 1995, and will allow you to use your Web browser to look at the news postings. While this will not stop spammers from trying to post to the groups, this will give you yet another way, besides using USENET news, to keep the junk out of your personal mail files. 2) Examples of subscribing and unsubscribing to the mailing lists. ------------------------------------------------------------------ PLEASE NOTE: The BIOSCI management does NOT act on subscription/unsubscription requests that are posted improperly to the newsgroups and mailing lists. People who do this only bother everyone on the lists to no avail. Please be sure to follow the proper procedures below. Gory details are in the BIOSCI Information sheets on the Web at http://www.bio.net. Below we give an example utilizing the METHODS-AND-REAGENTS list at both of our two BIOSCI sites: Users in the Americas and Pacific Rim countries who use the BIOSCI ------------------------------------------------------------------ node at computer net.bio.net: ---------------------------- A) Determine the "listname" which is the <=8 character mail address ^^^^^^^^^^^^^ for the group. These can be found in the BIOSCI Info. Sheet. For the METHODS-AND-REAGENTS group the mailing address is methods@net.bio.net. The listname is the portion of the address to the left of the @ sign, i.e., "methods". The listname is used with the "subscribe" and "unsubscribe" commands illustrated below. B) Mail all commands in the body of a mail message addressed to biosci-server@net.bio.net. Do NOT send commands to the newsgroup posting addresses! Leave the Subject: line blank, any text on it will be ignored. C) In the body of your message put one or more of the following commands with an "end" command on the last line, e.g., subscribe methods unsubscribe methods end Do NOT put your e-mail address or other text on these lines. The server only allows you to cancel your subscription if the address on your mail header matches the address on our mailing list. Please ask for help at biosci-help@net.bio.net if your address has changed, e.g., if you know you are on the list but the server tells you that you are not a member. Users in Europe, Africa, and Central Asia who use the BIOSCI node at -------------------------------------------------------------------- computer daresbury.ac.uk (also known as dl.ac.uk): ------------------------------------------------- To subscribe and unsubscribe to/from the BIOSCI lists, you need to specify the full USENET newsgroup name with "bionet-news." prepended. The USENET newsgroup names are listed in the BIOSCI Information sheet on the Web at http://www.bio.net/. For the METHODS-AND-REAGENTS list the USENET newsgroup name is bionet.molbio.methds-reagnts, thus the appropriate commands are sub bionet-news.bionet.molbio.methds-reagnts unsub bionet-news.bionet.molbio.methds-reagnts These commands are included in a message addressed to mxt@dl.ac.uk, NOT to the newsgroup mailing addresses. As usual, include the text in the body of the message as text on the Subject: line is ignored. To unsubscribe from all the lists at the UK node, use unsub bionet-news Please note that if the address in the list is different than the one in your mail message header, you will not be able to unsubscribe by this method. If you have problems, please mail biosci@daresbury.ac.uk. 3) How to access BIOSCI/bionet newsgroup archives. -------------------------------------------------- Back postings of all BIOSCI/bionet newsgroups can be found on the World Wide Web at URL http://www.bio.net/. There are several searchable newsgroup indices at this site. E-mail users can search the BIOSCI archives by using our waismail e-mail server. For instructions send the message help to waismail@net.bio.net. Leave the Subject: line blank (anything entered on the Subject: line is ignored). 4) The BIOSCI user address and research interest directory. ----------------------------------------------------------- Please take this opportunity to add your name, address, and research interest information to the BIOSCI User Address Database if you have not already done so. You can fill out the address form directly through our Web page at URL http://www.bio.net/adrform.html. The address database is reindexed nightly for WWW access (the URL is http://www.bio.net/). If you are not directly on the Internet but can reach it by e-mail, please use our waismail server to access the user directory. waismail use is described above. You can also request a user address form by e-mail from biosci-help@net.bio.net. Please check your database entry from time-to-time to see if your address information is still up-to-date. Because of our limited personnel resources, we ask that you resubmit a *complete* form to revise your entry; we only replace complete entries and do not have resources to edit old forms. Sincerely, Dave Kristofferson BIOSCI/bionet Manager biosci-help@net.bio.net From owner-embldatabank@net.bio.net Wed Dec 20 22:00:00 1995 Newsgroups: bionet.molbio.embldatabank,embnet.general Path: biosci!agate!newsxfer2.itd.umich.edu!newsfeed.internetmci.com!EU.net!peer-news.britain.eu.net!sunsite.doc.ic.ac.uk!hgmp.mrc.ac.uk!ebi.ac.uk!stoehr From: stoehr@ebi.ac.uk (Peter Stoehr) Subject: EMBL Release 45 Sender: news@ebi.ac.uk (Mr news) Message-ID: <1995Dec21.115055@ebi.ac.uk> Date: Thu, 21 Dec 1995 10:50:55 GMT Lines: 159 Organization: European BioInformatics Institute Release 45 of the EMBL Nucleotide Sequence Database is now available from the network servers of the European Bioinformatics Institute: Anonymous FTP server: ftp.ebi.ac.uk Directory: pub/databases/embl/release FASTA email server : FASTA@ebi.ac.uk Email retrieval : NetServ@ebi.ac.uk SRS WWW retrieval : http://www.ebi.ac.uk/srs/srsc We expect this release to become available in Europe via other EMBnet sites very shortly, if not already. The data files of release 45 total some 1.6GB in EMBL flat-file format. From the release notes: The EMBL nucleotide sequence database was frozen to make Release 45 on 4th December 1995. The release contains 622566 sequence entries comprising 427,620,278 nucleotides. This represents an increase of about 18% over Release 44. A breakdown of Release 45 by taxonomic division is shown below: Division Entries Nucleotides ----------------- ------- ----------- Bacteriophage 1140 1640505 ESTs 370663 128422650 Fungi 10456 27197150 Invertebrates 16592 45879687 Organelles 11687 12476847 Other Mammals 7445 8085941 Other Vertebrates 8658 9779295 Plants 13681 17196932 Primates 54129 47934830 Prokaryotes 27650 49323813 Rodents 27347 30975411 STSs 22072 7343968 Synthetic 11208 5368738 Unclassified 12234 5784538 Viruses 27604 30209973 ----------------- ------- ------------ Total 622566 427620278 plus: Other patents 3180 347998 ----------------- ------- ------------ Grand Total 625746 427968276 1.1 Database Cross-references At this release we have introduced a new feature table qualifier "/db_xref" to represent cross-references to external databases. This qualifier is valid, but optional, for all feature keys. There are two components to the cross-reference value, the name of the database and the identifier within that database being referenced, formatted as follows: /db_xref="database:identifier" In this release, we have included cross-references using the "/db_xref" on CDS features with the "database" values SWISS-PROT and PID described below. 1.1.1 SWISS-PROT A cross-reference from a CDS feature to the database "SWISS-PROT" indicates that this feature corresponds to the entry in the SWISS-PROT Protein Sequence Database with the given accession number, eg. /db_xref="SWISS-PROT:P22032" 1 Release Notes (Release 45) 1.1.2 PID A cross-reference from a CDS feature to the database "PID" (protein identifier) contains an identifier for the translated product of that coding sequence. This identifier will remain the same, despite changes to the sequence, as long as the translation remains the same. It can therefore be used by external databases (such as SWISS-PROT) as an identifier onto which cross-references can be built. These identifier values will be maintained in collaboration with NCBI so that they will be the same in GenBank. Eg. /db_xref="PID:g220291" 1.2 EST Database Files In order to keep the size of the data files within reasonable limits for handling purposes, we have split the EST division into several files. At this release we have created a fourth file of EST data named EST4.DAT. Additional files will be added in subsequent releases as appropriate. 2 FORTHCOMING CHANGES 2.1 *IMPORTANT* Notice Of Accession Number Format Change Nucleotide Sequence Database Collaborative Agreement, 31 May 1995 Currently, accession numbers used by the nucleotide sequence databases consist of one prefix letter followed by 5 digits. EST projects and projects to add patent data have accelerated the need to extend the accession number space. It is projected that the databases will run out of accession numbers within 8 to 10 months. It is clear that: * As much notice as possible should be given to users and software developers * The change should make a large enough space that another change will not be necessary in the foreseeable future. * The accession number should continue to be readily identifiable as a DDBJ/EMBL/GenBank accession number. The collaborators concluded that: * A new form of accession number will be created, defined as an 8-character alphanumeric string, beginning with two upper case letters and followed only by digits (e.g., SR004562). Leading and trailing zeros are significant. The letter 'O' will not be used. * Existing 6-character accession numbers will remain as they are, and will never be transformed to an 8-character form. * New accession numbers will not be used before February 1, 1996. The groups agree to avoid using new accession numbers as long as possible after that. The International Nucleotide Sequence Databases DDBJ/EMBL/GenBank 2.2 New Nucleic Acid Identifier (NI) Line We intend to introduce a new line type NI to contain an identifier for each nucleic acid sequence. While the sequence remains the same, so will the value of this identifier. When a sequence change occurs, however minor, a new NI value will be assigned whilst the accession number on the AC line may remain unchanged. These NI values are analagous to those to be represented in the NID lines of GenBank entries, and we will inherit GenBank NID values into our NI lines. Starting at release 47 (June 1996), each entry will have an NI line of the form: AC U35111; XX NI g1006834 From owner-embldatabank@net.bio.net Wed Dec 27 22:00:00 1995 Path: biosci!agate!ihnp4.ucsd.edu!library.ucla.edu!newsfeed.internetmci.com!uwm.edu!lll-winken.llnl.gov!nntp.coast.net!swidir.switch.ch!in2p3.fr!univ-lyon1.fr!jussieu.fr!pasteur.fr!infobiogen.fr!news From: Jean-Marc Plaza Newsgroups: bionet.software.srs,bionet.molbio.embldatabank Subject: (no subject) Date: 28 Dec 1995 11:40:46 GMT Organization: INFOBIOGEN Lines: 106 Message-ID: <4btvnu$9qk@lovelace.infobiogen.fr> NNTP-Posting-Host: lovelace.infobiogen.fr Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: quoted-printable X-Mailer: Mozilla 1.1N (X11; I; SunOS 5.4 sun4d) X-URL: news:bionet.software.srs Xref: biosci bionet.software.srs:205 bionet.molbio.embldatabank:582 Hi, there are several problems with EMBL 45 when you run trembl (Thure Etzold) on it. First, in CDS complement , trembl does a core dump when it finds : "complememt(>" instead of "complememt(" Secondly, The codon start for HSACTSG7 is /codon_start=2129 in EMBL 45 instead of 1, 2 or 3. And trembl does not like it -core dump. :-) In Genbank the codon start is /codon_start=1 for HUMACTSG7 and the translated sequence is different. Any idea to fix that ? Thanks Jean-Marc EMBL 45 ID HSACTSG7 standard; DNA; PRI; 466 BP. DE Human enteric smooth muscle gamma-actin gene, exon 9 and 3' flank. FT CDS_pept join(D00649:2129..2254,D00649:3135..3263,D00650:653..763, FT D00650:1033..1117,D00651:66..227,D00652:55..246,D00653:357 FT ..538,89..232) FT /note="gamma-actin precursor" FT /codon_start=2129 FT /db_xref="PID:e34116" FT /translation="PEWPQTASPWIRVVPWGIRRLLRFASMEYTKGKLPIFLAGNGMPVFT GEEADLFDDSVRVNYFNWYINEVLKAVKEDL= VDVRSYIVRSLIDGYEGPLGFSQRFGLYFT HVNFNDSSRPRTPRKSAYLFTSIIEKNGFSAKKVKRNPLPVRADFTSRARVTDSLPSEVFT PSK= AKISVEKFSKQPRFERDLFYDGRFRDDFLWGVSSSPYQIEGGWNADGKGPSIWDNFFT THTPGNGVKDNATGDVACDSYHQLDADLNILRTLKVKSYRFSISWSRIFPTGRNS= TINKFT QGVDYYNRLIDSLVDNNIFPMVTLFHWDLPQALQDIGGWENPSLIELFDSYADYCFKTFFT GDRVKFWMTFNEPWCHVVLGYSSGIFP= PSVQEPGWLPYKVSHIVIKAHARVYHTYDEKYFT RSEQKGVISLSLNTHWAEPKDPGLQRDVEAADRMLQFTMGWFAHPIFKNGDYPDVMKWTFT = VGNRSELQHLASSRLPTFTEEEKNYVRGTADVFCHNTYTSVFVQHSTPRLNPPSYDDDMFT ELKLIEMNSSTGVMHQDVPWGTRRLLNWIKEEYGNIPIYITENGQGLENPT= LDDTERIFFT YHKTYINEALKAYKLDGVDLRGYSAWTLMDDFEWLLGYTMRFGLYYVDFNHVSRPRTARFT ASARYYPDLIANNGMPLAREDEF= LYGEFPKGFIWSAASASYQVEGAWRADGKGLSIWDTFT FSHTPLRIGNDDNGDVACDSYHKIAEDVVALQNLGVSHYRFSIAWSRILPDGTTKFINEFT = AGLSYYVRFIDALLAAGITPQVTIYHWDLPQALQDVGGWENETIVQRFKEYADVLFQRLFT GDRVKFWITLNEPFVIAAQGYGTGVSAPGISFRPGTAPYIAGHNLIK= AHAEAWHLYNDVFT YRARQGGTISITISSDWGEPRDPTNREHVEAARSYVQFMGGWFAHPIFKNGDYPEVMKTFT RIRDRSLGAGLNKSRLPEF= TESEKSRIKGTFDFFGFNHNTTVLAYNLDYPAAFSSFDADFT RGVASIADSSWPVSGSFWLKVTPFGFRRILNWLKEEYNNPPIYVTENGVSRRGEPELNDFT = TDRIYYLRSYINEALKAVHDKVDLRGYTVWSIMDNFEWATGFAERFGVHFVNRSDPSLPFT RIPRASAKFYATIVRCNGFPDPAQGPHPCLQQPEDAAPTASPV= QSEVPFLGLMLGIAEAFT QTALYVLFALLLLGACSLAFLTYNTGRRSKQGNAQPSQHQLSPISSF"

ERROR:

syntax error, at "129 /db_xref="PID:e34116" /translation="PEWPQTASPWIRVVPWGIRRLLRFASMEYTKGKLPIFLAGNGM GENBANK 92 LOCUS HUMACTSG7 466 bp DNA PRI 23-JAN-1992 DEFINITION Human enteric smooth muscle gamma-actin gene, exon 9 and 3' flank. ACCESSION D00654 NID g219424 KEYWORDS actin; gamma-actin. SEGMENT 7 of 7 SOURCE Human peripheral blood genomic DNA, clone HACTSG-112. ORGANISM Homo sapiens Eukaryota; Animalia; Metazoa; Chordata; Vertebrata; Mammalia; Theria; Eutheria; Primates; Haplorhini; Catarrhini; Hominidae. REFERENCE 1 (bases 89 to 309) AUTHORS Miwa,T. and Kamada,S. TITLE The nucleotide sequence of a human smooth muscle (enteric type) gamma-actin cDNA JOURNAL Nucleic Acids Res. 18, 4263-4263 (1990) MEDLINE 90332437 REFERENCE 2 (bases 1 to 466) AUTHORS Miwa,T., Manabe,Y., Kurokawa,K., Kamada,S., Kanda,N., Bruns,G., Ueyama,H. and Kakunaga,T. TITLE Structure, chromosome location, and expression of the human smooth muscle (enteric type) gamma-actin gene: evolution of six human actin genes JOURNAL Mol. Cell. Biol. 11, 3296-3306 (1991) MEDLINE 91246198 COMMENT These data kindly submitted in computer readable form by: Takeshi Miwa Department of Oncogene Research Research Institute for Microbial Diseases Osaka University 3-1 Yamadaoka Suita Osaka 565 Japan Phone: 06-875-2470 Fax: 06-875-1292. NCBI gi: 219424 FEATURES Location/Qualifiers 1..466 /organism="Homo sapiens" CDS_pept join(D00649:2129..2254,D00649:3135..3263,D00650:653..763, D00650:1033..1117,D00651:66..227,D00652:55..246, D00653:357..538,89..232) /note="gamma-actin precursor; NCBI gi: 219426" /codon_start=1 /db_xref="PID:g219426" /translation="MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGV MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEH PTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGV THNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLC YVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIH ETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP ERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF" --------------------------------------------------- Jean-Marc PLAZA INFOBIOGEN - CNRS 7, rue Guy Moquet BP8 94801 VILLEJUIF Cedex, France tel: +33 45 59 52 39 fax: +33 45 59 52 50 e-mail: plaza@infobiogen.fr --------------------------------------------------- From owner-embldatabank@net.bio.net Wed Dec 27 22:00:00 1995 Path: biosci!agate!ihnp4.ucsd.edu!swrinde!cs.utexas.edu!howland.reston.ans.net!nntp.coast.net!swidir.switch.ch!in2p3.fr!univ-lyon1.fr!jussieu.fr!pasteur.fr!infobiogen.fr!news From: Jean-Marc Plaza Newsgroups: bionet.molbio.embldatabank,bionet.software.srs Subject: trembl and EMBL 45 Date: 28 Dec 1995 11:43:50 GMT Organization: INFOBIOGEN Lines: 123 Message-ID: <4btvtm$9qk@lovelace.infobiogen.fr> NNTP-Posting-Host: lovelace.infobiogen.fr Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 1.1N (X11; I; SunOS 5.4 sun4d) X-URL: news:bionet.molbio.embldatabank?ALL Xref: biosci bionet.molbio.embldatabank:583 bionet.software.srs:206 Sorry, I forgot the subjecty so I post it again: Hi, there are several problems with EMBL 45 when you run trembl (Thure Etzold) on it. First, in CDS complement , trembl does a core dump when it finds : "complememt(>" instead of "complememt(" Secondly, The codon start for HSACTSG7 is /codon_start!29 in EMBL 45 instead of 1, 2 or 3. And trembl does not like it -core dump. :-) In Genbank the codon start is /codon_start=1 for HUMACTSG7 and the translated sequence is different. Any idea to fix that ? Thanks Jean-Marc EMBL 45 ID HSACTSG7 standard; DNA; PRI; 466 BP. DE Human enteric smooth muscle gamma-actin gene, exon 9 and 3' flank. FT CDS_pept join(D00649:2129..2254,D00649:3135..3263,D00650:653..763, FT D00650:1033..1117,D00651:66..227,D00652:55..246,D00653:357 FT ..538,89..232) FT /note="gamma-actin precursor" FT /codon_start!29 FT /db_xref="PID:e34116" FT /translation="PEWPQTASPWIRVVPWGIRRLLRFASMEYTKGKLPIFLAGNGMPVFT GEEADLFDDSVRVNYFNWYINEVLKAVKEDL VDVRSYIVRSLIDGYEGPLGFSQRFGLYFT HVNFNDSSRPRTPRKSAYLFTSIIEKNGFSAKKVKRNPLPVRADFTSRARVTDSLPSEVFT PSK AKISVEKFSKQPRFERDLFYDGRFRDDFLWGVSSSPYQIEGGWNADGKGPSIWDNFFT THTPGNGVKDNATGDVACDSYHQLDADLNILRTLKVKSYRFSISWSRIFPTGRNS TINKFT QGVDYYNRLIDSLVDNNIFPMVTLFHWDLPQALQDIGGWENPSLIELFDSYADYCFKTFFT GDRVKFWMTFNEPWCHVVLGYSSGIFP PSVQEPGWLPYKVSHIVIKAHARVYHTYDEKYFT RSEQKGVISLSLNTHWAEPKDPGLQRDVEAADRMLQFTMGWFAHPIFKNGDYPDVMKWTFT VGNRSELQHLASSRLPTFTEEEKNYVRGTADVFCHNTYTSVFVQHSTPRLNPPSYDDDMFT ELKLIEMNSSTGVMHQDVPWGTRRLLNWIKEEYGNIPIYITENGQGLENPT LDDTERIFFT YHKTYINEALKAYKLDGVDLRGYSAWTLMDDFEWLLGYTMRFGLYYVDFNHVSRPRTARFT ASARYYPDLIANNGMPLAREDEF LYGEFPKGFIWSAASASYQVEGAWRADGKGLSIWDTFT FSHTPLRIGNDDNGDVACDSYHKIAEDVVALQNLGVSHYRFSIAWSRILPDGTTKFINEFT AGLSYYVRFIDALLAAGITPQVTIYHWDLPQALQDVGGWENETIVQRFKEYADVLFQRLFT GDRVKFWITLNEPFVIAAQGYGTGVSAPGISFRPGTAPYIAGHNLIK AHAEAWHLYNDVFT YRARQGGTISITISSDWGEPRDPTNREHVEAARSYVQFMGGWFAHPIFKNGDYPEVMKTFT RIRDRSLGAGLNKSRLPEF TESEKSRIKGTFDFFGFNHNTTVLAYNLDYPAAFSSFDADFT RGVASIADSSWPVSGSFWLKVTPFGFRRILNWLKEEYNNPPIYVTENGVSRRGEPELNDFT TDRIYYLRSYINEALKAVHDKVDLRGYTVWSIMDNFEWATGFAERFGVHFVNRSDPSLPFT RIPRASAKFYATIVRCNGFPDPAQGPHPCLQQPEDAAPTASPV QSEVPFLGLMLGIAEAFT QTALYVLFALLLLGACSLAFLTYNTGRRSKQGNAQPSQHQLSPISSF"

ERROR:

syntax error, at "129 /db_xref="PID:e34116" /translation="PEWPQTASPWIRVVPWGIRRLLRFASMEYTKGKLPIFLAGNGM GENBANK 92 LOCUS HUMACTSG7 466 bp DNA PRI 23-JAN-1992 DEFINITION Human enteric smooth muscle gamma-actin gene, exon 9 and 3' flank. ACCESSION D00654 NID g219424 KEYWORDS actin; gamma-actin. SEGMENT 7 of 7 SOURCE Human peripheral blood genomic DNA, clone HACTSG-112. ORGANISM Homo sapiens Eukaryota; Animalia; Metazoa; Chordata; Vertebrata; Mammalia; Theria; Eutheria; Primates; Haplorhini; Catarrhini; Hominidae. REFERENCE 1 (bases 89 to 309) AUTHORS Miwa,T. and Kamada,S. TITLE The nucleotide sequence of a human smooth muscle (enteric type) gamma-actin cDNA JOURNAL Nucleic Acids Res. 18, 4263-4263 (1990) MEDLINE 90332437 REFERENCE 2 (bases 1 to 466) AUTHORS Miwa,T., Manabe,Y., Kurokawa,K., Kamada,S., Kanda,N., Bruns,G., Ueyama,H. and Kakunaga,T. TITLE Structure, chromosome location, and expression of the human smooth muscle (enteric type) gamma-actin gene: evolution of six human actin genes JOURNAL Mol. Cell. Biol. 11, 3296-3306 (1991) MEDLINE 91246198 COMMENT These data kindly submitted in computer readable form by: Takeshi Miwa Department of Oncogene Research Research Institute for Microbial Diseases Osaka University 3-1 Yamadaoka Suita Osaka 565 Japan Phone: 06-875-2470 Fax: 06-875-1292. NCBI gi: 219424 FEATURES Location/Qualifiers 1..466 /organism="Homo sapiens" CDS_pept join(D00649:2129..2254,D00649:3135..3263,D00650:653..763, D00650:1033..1117,D00651:66..227,D00652:55..246, D00653:357..538,89..232) /note="gamma-actin precursor; NCBI gi: 219426" /codon_start=1 /db_xref="PID:g219426" /translation="MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGV MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEH PTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGV THNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLC YVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIH ETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP ERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF" --------------------------------------------------- Jean-Marc PLAZA INFOBIOGEN - CNRS 7, rue Guy Moquet BP8 94801 VILLEJUIF Cedex, France tel: +33 45 59 52 39 fax: +33 45 59 52 50