From owner-embldatabank@net.bio.net Mon Apr 01 23:00:00 1996 Path: biosci!agate!usenet.ins.cwru.edu!gatech!newsfeed.internetmci.com!uwm.edu!chi-news.cic.net!news.uoregon.edu!newsfeed.orst.edu!news.orst.edu!ava.bcc.orst.edu!fieldk From: fieldk@ava.bcc.orst.edu (Katharine Field) Newsgroups: bionet.molbio.embldatabank Subject: Molecular Biology Workshop Date: 1 Apr 1996 17:16:52 GMT Organization: Oregon State University Lines: 143 Message-ID: <4jp324$agn@news.orst.edu> NNTP-Posting-Host: ava.bcc.orst.edu Announcing a Workshop on Methods in Molecular Biology at Oregon State University 1996 Offered by the Molecular and Cellular Biology Program Oregon State University Corvallis, Oregon (541) 737-3799 An intensive training course for graduate students, faculty and researchers in the biological and medical sciences The methods of molecular biology, in particular recombinant DNA work, have transformed research in the biological and medical sciences. This technology currently influences all aspects of biological research, has far-reaching applications in clinical diagnosis, and has led to economically important developments in agriculture and biotechnology. This course provides a hands-on introduction to molecular biological methods. Participants will spend two weeks in intensive laboratory work. In addition, daily lectures by molecular biologists will provide theoretical background and insight into cutting-edge research developments and techniques. Participants will learn the following techniques: cloning vector manipulation the polymerase chain reaction (PCR) preparation of recombinant DNA transformation of bacterial cells isolation of genomic DNA and RNA restriction analysis handling of radioactive isotopes isotopic and non-isotopic probe labelling Southern blots site-directed mutagenesis northern blots DNA sequencing synthesis of a fusion protein protein expression western blots Prerequisites: A good, recent background in DNA structure and chemistry, genetics and biochemistry. Schedule: MCB 525 - Methods in Molecular Biology Session 1 July 15 - July 27, 1996 Session 2 September 9 - September 21, 1996 This is a highly intensive training course, requiring a full-time committment from the participants. Activities are scheduled all day and some evenings. Classes begin in the laboratory at 8:00 AM. The lecture portion of the course is at 1:00 PM. There will be one Sunday off in the middle of the session. Registration will be limited to 24 students per session. A limited number of places in the course will be reserved for MCB students and other OSU graduate students who are required to take the course as part of their programs. All other course participants will be charged a workshop fee of $750 to take the course, or $900 to take the course and receive 3 credits through Continuing Higher Education (CHE). Important!!! OSU graduate students who are required to take MCB 525 as part of their graduate program must provide copies of their official programs, or a letter from their major professors, along with the application, in order to be considered for the course. Registration, Fees & Credit Please fill out and return by April 15, 1996. You will be notified if you have been accepted and registration forms will be mailed to you. You do not need to send in an application if you will be taking the lecture course only. Workshop fees must be paid in full by two weeks before the first day of class. Lectures only: MCB 524 - is offered as a 1-credit, pass/no pass course through the summer school (July) or as a fall-term course (September). There is no limit on enrollment. The course consists of approximately 15 one-hour lectures. MCB 525 students may not take MCB 524. Staff: Dr. Katharine Field, Coordinator Dr. Walt Ream, co-coordinator Dr. Gary Merrill, co-coordinator Faculty of the Molecular and Cellular Biology Program Housing: Housing in studio "quad" apartments (single rooms with shared kitchen and bath) is available close to campus at a cost of $185 for two weeks. Restaurants are a short distance from class. A campus parking permit can be purchased for $5 per week. Class participants can use Dixon Recreation Center (lockers, swimming, weight room, exercise equipment, outdoor track, and more) for $3 per day. Location: The class will be held in the new Agricultural and Life Sciences Building on the Oregon State University campus in Corvallis. Corvallis is a community of 45,000 residents located in the beautiful Willamette River Valley, an hour from the Pacific Coast and the Cascade Range. APPLICATION: ------------------------------------------------------------------------------ Name: Position: Organization or School, P. I.'s name: Highest Degree, Date: Address: City: State: Zip: Phone: (work) (home) email address: Preferred Session: _____July 15-July 27, 1996 _____September 9 - September 21, 1996 Status: _____ Graduate Course for Credit/Program _____ Workshop Course - no credit ($750) _____ Workshop Course - 3 credits from CHE ($900) If you do not get into your preferred session, do you want to be considered for the other session? _____ Yes _____ No I will need housing _____ Yes _____ No Return to: MCB 525 Application Molecular and Cellular Biology 3021 Agricultural and Life Sciences Oregon State University Corvallis, OR 97331-7303 Or send via email to mcb@bcc.orst.edu Further Questions: Please call (541) 737-3799 or email mcb@bcc.orst.edu Oregon State University is an Affirmative Action/Equal Opportunity employer and complies with Section 504 of the Rehabilitation Act of 1973. From owner-embldatabank@net.bio.net Tue Apr 02 23:00:00 1996 Path: biosci!daresbury!nntp-trd.UNINETT.no!newsfeed.sunet.se!news01.sunet.se!sunic!news99.sunet.se!news.funet.fi!news.csc.fi!nokia.fi!news.nmp.nokia.com!ourf14.nmp.nokia.com!jpn From: jpn@ourf14.nmp.nokia.com (Jukka Polonen) Newsgroups: bionet.molbio.embldatabank Subject: q Date: 2 Apr 1996 12:43:00 GMT Organization: Nokia Mobile Phones Lines: 1 Message-ID: <4jr7ck$j6t@sanfs04.nmp.nokia.com> NNTP-Posting-Host: ourf14.nmp.nokia.com X-Newsreader: TIN [version 1.2 PL2] From owner-embldatabank@net.bio.net Tue Apr 02 23:00:00 1996 Newsgroups: bionet.molbio.embldatabank Path: biosci!daresbury!hgmp.mrc.ac.uk!ebi.ac.uk!EMBL-EBI.ac.uk!malik From: malik@EMBL-EBI.ac.uk (Ansar Malik) Subject: ANNOUNCEMENT: Immunogenetics IMGT database - update Sender: news@ebi.ac.uk (Mr news) Message-ID: Date: Wed, 3 Apr 1996 10:50:13 GMT Lines: 56 Reply-To: malik@EMBL-EBI.ac.uk (Ansar Malik) Organization: European Bioinformatics Institute (EMBL) - UK X-Newsreader: mxrn 6.18-32 Keywords: database, immunology, T-cell-receptor, sequences, immunogenetics. IMMUNOGENETICS IMGT DATABASE =================================== Professor Marie-Paule LEFRANC Laboratoire d'ImmunoGenetique Moleculaire, LIGM UMR CNRS 9942, Institut de Genetique Moleculaire BP 5051, 1919 route de Mende, 34033 MONTPELLIER Cedex 1 FRANCE Telephone: (33) 67 61 36 34 FAX : (33) 67 04 02 31/67 04 02 45 e-mail : lefranc@ligm.crbm.cnrs-mop.fr INTRODUCTION ============ The ImMunoGeneTics database, IMGT, is an integrated specialised database containing nucleotide sequence information of genes important in the function of the immune system. It collects and annotates sequences belonging to the immunoglobulin superfamily which are involved in immune recognition, these are the B cell antigen receptor (Immunoglobulin or Ig), the T cell antigen receptor (TCR) (LIGM-database) and the class I and class II molecules of the Human Leucocyte Antigens (HLA) system (HLA-database). IMGT/LIGM DATABASE ================== An integrated immumogenetics database (IMGT/LIGM) specialising in Ig and TcR is under development through collaboration between LIGM, IFG and EMBL oustation EBI. This database consists of the Ig and TcR sequence entries. Collaborators: Release 3 (March 1996) contains 5109 fully annotated sequence entries. LIGM Montpellier :Marie-Paule Lefranc (coordinator) Veronique Giudicelli,Denys Chaume EMBL-EBI :Ansar Malik IFG :Werner Mueller MRC :Ian Tomlinson ACCESS/DATA DISTRIBUTION ======================== WWW server: http://www.ebi.ac.uk/imgt/ FTP server: ftp.ebi.ac.uk/pub/databases/imgt E_MAIL server: email netserv@ebi.ac.uk -- send "help IMGT" in the mail body. This database is available on CD-ROM as an acompanying database to the EMBL Nucleotide Sequence Database at nominal cost. ======================================================================= Ansar Malik Ph.D | Email:Malik@ebi.ac.uk EBI - European Bioinformatics Institute | URL: http://www.ebi.ac.uk Hinxton Hall, Hinxton | Tel: +44 (1223) 494417 Cambridge CB10 1RQ, UK | Fax: +44 (1223) 494968 ======================================================================== From owner-embldatabank@net.bio.net Fri Apr 05 23:00:00 1996 Path: biosci!biosci!not-for-mail From: apweiler@ebi.ac.uk (Rolf Apweiler) Newsgroups: ebi.servers,bionet.general,bionet.molbio.embldatabank,bionet.molbio.proteins,embnet.general Subject: ANNOUNCEMENT: Beta release of TREMBL, a supplement to SWISS-PROT Date: 6 Apr 1996 15:53:05 -0800 Organization: European Bioinformatics Institute (EMBL) - UK Lines: 81 Sender: daemon@net.bio.net Distribution: world Message-ID: Reply-To: apweiler@ebi.ac.uk (Rolf Apweiler) NNTP-Posting-Host: net.bio.net Xref: biosci bionet.general:20998 bionet.molbio.embldatabank:624 bionet.molbio.proteins:7526 The Beta release of TREMBL, a protein sequence database supplementing the SWISS-PROT Protein Sequence Data Bank is now available from ftp.ebi.ac.uk in directory /pub/databases/trembl. INTRODUCTION ============ TREMBL is a protein sequence database supplementing the SWISS-PROT Protein Sequence Data Bank. TREMBL contains the translations of all coding sequences (CDS) present in the EMBL Nucleotide Sequence Database not integrated in SWISS-PROT. At the moment we treat TREMBL as an independent dataset in SWISS-PROT format, but shortly TREMBL will become a part of SWISS-PROT. BETA RELEASE OF TREMBL ====================== This TREMBL release is created from the EMBL nucleotide sequence release 46 and contains 98'447 sequence entries, comprising 25'879'831 amino acids. TREMBL is split in two main sections; SP-TREMBL and REM-TREMBL: SP-TREMBL (SWISS-PROT TREMBL) contains the entries (81'861) which should be incorporated into SWISS-PROT. SP-TREMBL is partially redundant against SWISS-PROT, since approximately 40'000 SP-TREMBL entries are only additional sequence reports of proteins already in SWISS-PROT. We will try to merge these sequence reports as fast as possible with the already existing SWISS-PROT entries for these proteins, so as to make SWISS-PROT and TREMBL completely nonredundant. SP-TREMBL is organized in subsections: fun.dat (Fungi): 3772 entries inv.dat (Invertebrates): 9689 entries mam.dat (Other Mammals): 1907 entries mhc.dat (MHC proteins): 2007 entries org.dat (Organelles): 5241 entries phg.dat (Bacteriophages): 939 entries Pln.dat (Plants): 5294 entries pri.dat (Primates): 6425 entries pro.dat (Prokaryotes): 15645 entries rod.dat (Rodents): 5837 entries unc.dat (Unclassified): 201 entries vrl.dat (Viruses): 22677 entries vrt.dat (Other Vertebrates): 2227 entries REM-TREMBL (REMaining TREMBL) contains the entries (16'586) that we do not want to include in SWISS-PROT. ACCESS/DATA DISTRIBUTION ======================== FTP server: ftp.ebi.ac.uk/pub/databases/trembl TREMBL is also available on the SWISS-PROT CD-ROM. TREMBL HAS BEEN PREPARED BY: ============================ Rolf Apweiler, Alain Gateau, Vivien Junker, Fiona Lang, and Claire O'Donovan at the EMBL Outstation - European Bioinformatics Institute (EBI) in Hinxton; Amos Bairoch at the Medical Biochemistry Department of the University of Geneva. ======================================================================= Rolf Apweiler | Email:apweiler@ebi.ac.uk EBI - European Bioinformatics Institute | URL: http://www.ebi.ac.uk Wellcome Trust Genome Campus, Hinxton | Tel: +44 (1223) 494435 Cambridge CB10 1RQ, UK | Fax: +44 (1223) 494968 ======================================================================== From owner-embldatabank@net.bio.net Mon Apr 08 23:00:00 1996 Path: biosci!uunet.uu.net!aditya!raman From: aditya!raman@uunet.uu.net (K. Ramnarayan) Newsgroups: bionet.molbio.embldatabank Subject: (none) Date: 9 Apr 1996 13:22:40 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 1 Sender: daemon@net.bio.net Distribution: world Message-ID: <199604031649.IAA05464@aditya.tbc.com> NNTP-Posting-Host: net.bio.net unsubscribe embl-db ramnarayan From owner-embldatabank@net.bio.net Mon Apr 08 23:00:00 1996 Path: biosci!daresbury!usenet From: Martin Hilbers Newsgroups: bionet.molbio.embldatabank,embnet.general Subject: Re: ANNOUNCEMENT: Beta release of TREMBL, a supplement to SWISS-PROT Date: 9 Apr 1996 10:12:38 GMT Organization: Daresbury Lab, Warrington, U.K. Lines: 18 Distribution: bionet Message-ID: <4kdd6m$kfs@mserv1.dl.ac.uk> References: NNTP-Posting-Host: s-ind2.dl.ac.uk Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 1.1IS (X11; I; IRIX 5.3 IP12) X-URL: news:DpE8y8.H1G@ebi.ac.uk Wow, Looks nice. But what is the relation between this TREMBL and the TREMBL produced by Thure Etzold in Heidelberg, which was also created from EMBL 46.0 and contains 169636 entries ? Martin -- --------------------------------------------------------------------------- | Martin Hilbers | E-mail: m.p.hilbers@dl.ac.uk | | SEQNET | Tel: +44-1925-603492 | | Daresbury Laboratory | Fax: +44-1925-603100 | | Daresbury, Warrington |----------------------------------------------| | Cheshire WA4 4AD | SEQNET is the UK national EMBNet node | | United Kingdom | http://www.dl.ac.uk/SEQNET/home.html | --------------------------------------------------------------------------- From owner-embldatabank@net.bio.net Mon Apr 08 23:00:00 1996 Path: biosci!biosci!not-for-mail From: Matteo diTommaso Newsgroups: hinxton.announce,embnet.general,ebi.general,bionet.software,bionet.molbio.embldatabank Subject: "SynCron" - Tools for EMBL Database Update Date: 8 Apr 1996 21:39:21 -0700 Organization: European Bioinformatics Institute Lines: 72 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Xref: biosci bionet.software:15195 bionet.molbio.embldatabank:625 Subj="SynCron" tools for maintaining synchronised copies of the EMBL Nucleotide Sequence Database Looking at the statistics for access to the EMBL Nucleotide Sequence Database update files on the EBI ftp site (ftp://ftp.ebi.ac.uk/pub/databases/embl/new/) we observe that many people download the full cumulative data file (cumulative.dat) rather than the daily update files. In an attempt to make daily update files more useful and to provide a reliable mechanism for re-generating the cumulative.dat file locally from daily updates, the EBI and the Swiss EMBNet node have jointly developed a set of tools which can be used to fetch the daily updates and update the local database. The programs make use of 'transaction listings' made available on the EBI ftp site. These transaction listings are now supplied with every update file and include a record of each update, insert and delete operation to the EMBL Nucleotide Sequence Database as represented in the flat-file updates. The naming scheme for transaction listings is the same as for daily, weekly, and cumulative updates with the extension ".lis". The transaction listings are found in: ftp://ftp.ebi.ac.uk/pub/databases/embl/new/list/ and look like: Acc# ID Action DateStamp Ver# Division T58328 AA328 U 19951108232958 3 EST T58329 AA329 C 19951108233007 3 EST T58330 AA330 D 19951108233015 3 EST R67977 AA977 U 19951108230600 3 EST R67978 AA978 U 19951108230611 3 EST where U=Update C=Create D=Delete Using the tools it is possible to regenerate the cumulative.dat file (at a remote site) reliably from daily updates. Validation of the new cumulative.dat file is also possible using the transaction listing provided at the EBI. Using these programs it should be possible to keep a copy of the EMBL Nucleotide Sequence Database that exactly matches the contents of the database in operation at the EBI for external services with manual intervention required only in the event of some failure in network transfer of the file - etc. These programs are available by anonymous ftp from (the _002 version number will change as the programs are updated): UNIX Version: ftp://ftp.ebi.ac.uk/pub/software/unix/listtools/SynCron_002.tar.gz VMS Version: (backup/gzip) ftp://ftp.ebi.ac.uk/pub/software/vms/listtools/SynCron_002.bck-gz OR (tar/compress) ftp://ftp.ebi.ac.uk/pub/software/vms/listtools/SynCron_002.tar_Z Matteo diTommaso Database Programming Group EMBL Outstation The European Bioinformatics Institute E-mail: ditommaso@ebi.ac.uk Nicole Redaschi and Reinhard Doelz Biozentrum - University of Basel EMBnet Node Switzerland E-Mail: embnet@comp.bioz.unibas.ch From owner-embldatabank@net.bio.net Wed Apr 10 23:00:00 1996 Newsgroups: bionet.molbio.embldatabank,embnet.general Path: biosci!daresbury!hgmp.mrc.ac.uk!ebi.ac.uk!EMBL-EBI.ac.uk!apweiler From: apweiler@EMBL-EBI.ac.uk (Rolf Apweiler) Subject: Re: ANNOUNCEMENT: Beta release of TREMBL, a supplement to SWISS-PROT Sender: news@ebi.ac.uk (Mr news) Message-ID: Date: Thu, 11 Apr 1996 11:47:22 GMT Distribution: bionet Lines: 122 Reply-To: apweiler@EMBL-EBI.ac.uk (Rolf Apweiler) References: <4kdd6m$kfs@mserv1.dl.ac.uk> Organization: European Bioinformatics Institute (EMBL) - UK X-Newsreader: mxrn 6.18-32 In article <4kdd6m$kfs@mserv1.dl.ac.uk>, Martin Hilbers writes: >Wow, > >Looks nice. But what is the relation between this TREMBL and the TREMBL >produced by Thure Etzold in Heidelberg, which was also created from >EMBL 46.0 and contains 169636 entries ? > > >Martin Hi Martin, Thure Etzolds TREMBL and TREMBL done by SWISS-PROT are related. TREMBL done by SWISS-PROT is the successor or the next generation of Thures TREMBL. SWISS-PROT kept the name TREMBL for their Translation of EMBL CDS, since the tools used to create the translations of the CDS are based on the program 'trembl' written by Thure Etzold at the EMBL in Heidelberg. So, what are the differences? Thure translates all CDS in the EMBL nucleotide sequence database into TREMBL entries. TREMBL done by SWISS-PROT excludes all the entries which are already integrated in SWISS-PROT to make SWISS-PROT and TREMBL non-redundant. Also, all TREMBL entries are in SWISS-PROT format and SWISS-PROT merges TREMBL entries and adds computer generated annotation, references and cross-references to other databases. So, the entries are quite different. An example see below. In June the first official release of TREMBL done by SWISS-PROT will be available and at that stage Thures TREMBL will disappear. However, everybody who wants to generate a translation of all EMBL CDS as single entries can still use Thures program 'trembl' to do so; it will be distributed as part of SRS. For more information see the release notes of TREMBL and SWISS-PROT or read: Bairoch A., and Apweiler R. The SWISS-PROT protein sequence data bank and its new supplement TREMBL. Nucleic Acids Res. 24:21-25(1996). We hope this info helps. Rolf Apweiler and Thure Etzold Examples Thures TREMBL entry: ID S64977_2 standard; PRT; 228 AA. AC S64977; DR EMBL; S64977; S64977. DE gene: "COII"; DE COI=cytochrome oxidase subunit I...COIII=cytochrome oxidase subunit DE III [Drosophila simulans, Mitochondrial, 8 genes, 1990 nt] OS Drosophila simulans (fruit fly) OC Eukaryota; Animalia; Metazoa; Arthropoda; Uniramia; Insecta; OC Pterygota; Neoptera; Holometabola; Diptera; Brachycera; OC Cyclorrhapha; Schizophora; Drosophiloidea; Drosophilidae. OG Mitochondrion FT CDS 115..799 FT /note="Description: cytochrome oxidase subunit II" FT /gene="COII" FT /db_xref="FLYBASE:FBgn0012877" FT /db_xref="PID:e87967" FT /translation="MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFML FT FFNNYVNRFLLHGQLIEMIWTILPAIILLFIALPSLRLLYLLDEINEPSVTLKSIGHQW FT YWSYEYSDFNNIEFDSYMIPTNELSIDGFRLLDVDNRVILPMNSQIRILVTAADVIHSW FT TIPALGVKVDGTPGRLNQTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNHFIKW FT ISSNNS" CC translated using genetic code table "Invertebrate Mitochondrial" SQ Sequence 228 BP; >S64977_2 MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNNYVNRFLLHGQL IEMIWTILPAIILLFIALPSLRLLYLLDEINEPSVTLKSIGHQWYWSYEYSDFNNIEFDS YMIPTNELSIDGFRLLDVDNRVILPMNSQIRILVTAADVIHSWTIPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNHFIKWISSNNS Corresponding SWISS-PROT TREMBL entry: ID E87967 PRELIMINARY; PRT; 228 AA. DT 26-MAR-1996 (EMBLREL. 46, CREATED) DT 26-MAR-1996 (EMBLREL. 46, LAST SEQUENCE UPDATE) DT 26-MAR-1996 (EMBLREL. 46, LAST ANNOTATION UPDATE) DE CYTOCHROME C OXIDASE POLYPEPTIDE II (EC 1.9.3.1). GN COII. OS DROSOPHILA SIMULANS (FRUIT FLY). OG MITOCHONDRION. OC EUKARYOTA; METAZOA; ARTHROPODA; INSECTA; DIPTERA. RN [1] RP SEQUENCE FROM N.A. RX MEDLINE; 93374296. RA KANEKO M., SATTA Y., MATSUURA E.T., CHIGUSA S.I.; RL GENET. RES. 61:195-204(1993). CC -!- CATALYTIC ACTIVITY: 4 FERROCYTOCHROME C + O(2) = 2 H(2)O + 4 CC FERRICYTOCHROME C. CC -!- FUNCTION: SUBUNIT I AND II FORM THE FUNCTIONAL CORE OF THE ENZYME CC COMPLEX. ELECTRONS ORIGINATING IN CYTOCHROME C ARE TRANSFERRED VIA CC HEME A AND CU(A) TO THE BINUCLEAR CENTER FORMED BY HEME A3 AND CC CU(B). SUBUNIT II BINDS CU(A) AND CYTOCHROME C. CC -!- COFACTOR: COPPER A AND HEME GROUP. CC -!- SUBCELLULAR LOCATION: INTEGRAL MEMBRANE PROTEIN. (MITOCHONDRIAL). CC -!- SIMILARITY: TO OTHER MITOCHONDRIAL OR BACTERIAL COX2 SUBUNITS. DR EMBL; S64977; E87967; -. DR FLYBASE; FBGN0012877; DSIM\MT:COI. DR PROSITE; PS00078; COX2. KW MITOCHONDRION; OXIDOREDUCTASE; COPPER; TRANSMEMBRANE. FT METAL 196 196 COPPER A (PROBABLE). FT METAL 200 200 COPPER A (PROBABLE). FT METAL 204 >204 COPPER A (PROBABLE). SQ SEQUENCE 228 AA; 26160 MW; 0E17E9D6 CRC32; MSTWANLGLQ DSASPLMEQL IFFHDHALLI LVMITVLVGY LMFMLFFNNY VNRFLLHGQL IEMIWTILPA IILLFIALPS LRLLYLLDEI NEPSVTLKSI GHQWYWSYEY SDFNNIEFDS YMIPTNELSI DGFRLLDVDN RVILPMNSQI RILVTAADVI HSWTIPALGV KVDGTPGRLN QTNFFINRPG LFYGQCSEIC GANHSFMPIV IESVPVNHFI KWISSNNS // From owner-embldatabank@net.bio.net Sun Apr 28 23:00:00 1996 Path: biosci!bcm.tmc.edu!pendragon!news.msfc.nasa.gov!newsfeed.internetmci.com!in2.uu.net!news2.digex.net!usenet From: Vadim Babenko <74672.2423@compuserve.com> Newsgroups: bionet.molbio.embldatabank Subject: MAC Version of FREE Vector NTI Viewer Date: 29 Apr 1996 17:41:06 GMT Organization: Express Access Online Communications, USA Lines: 13 Message-ID: <4m2uvi$8bj@news4.digex.net> NNTP-Posting-Host: informax.digex.net InforMax, Inc., a provider of molecular biology software and general software solutions, has released the MAC version of its FREE Vector NTI Viewer which can be downloaded from http://www.informaxinc.com. The Viewer can be installed as a helper application within WWW browsers, such as Netscape or Microsoft Internet Explorer, to retrieve and visualize molecule data in Vector NTI Molecule Document, GenBank, EMBL and FASTA formats. It also makes it possible to visualize structures stored as MIME attachments in Internet mail messages. The Viewer can read GenBank, EMBL, FASTA files and unannotated nucleotide sequences from ASCII files and create and visualize virtual molecules for them. The Viewer allows simple molecule analysis - searching for restriction sites, ORFs, etc. Publication-quality graphics maps may be printed, saved in an external file, or transferred via the clipboard to other applications quickly and easily for inclusion in articles and reports.