From owner-repertoires@net.bio.net Sun Sep 01 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: Molreps FAQ for September 1996 Date: 2 Sep 1996 11:56:52 +0100 Lines: 232 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <50eehk$ii1@mserv1.dl.ac.uk> MIME-Version: 1.0 X-Authentication: none Original-To: molreps@dl.ac.uk M O L R E P S F R E Q U E N T L Y A S K E D Q U E S T I O N S ************* ******************* ********* ***************** **1 Where can I obtain libraries?** 1.1 _Phage Libraries_ You can try approaching the following people and organisations: 1.1.1 pIII/6-mer, pIII/15-mer, pVIII-4/15-mer libraries: George Smith, University of Missouri, FAX +1-573-882-0123 1.1.2 pVIII/9-mer, pVIII/9-merCys and pVIII/zinc-finger phagemid libraries: Alessandra Luzzago, IRBM P. Angeletti, luzzago@irbm.it Franco Felici, IRBM P. Angeletti, felici@irbm.it (NON-COMMERCIAL USERS ONLY) 1.1.3 Antibody scFvs with synthetic CDRs: Greg Winter, MRC-LMB Cambridge, gw@mrc-lmb.cam.ac.uk (NON-COMMERCIAL USERS ONLY) 1.1.4 Commercial Sources: Stratagene (Fab fragments in phage lambda) Affymax Pharmacia Cambridge Antibody Technology New England Biolabs (pIII/7-mer). (NEB catalog, p.166). see also this URL -> http://vent.neb.com/neb/phd/phd.html 1.2 _Synthetic Peptide Libraries_ 1.2.1 Commercial Sources: Affymax Chiron Corporation Most of the major peptide companies will custom-synthesise a library to your requirements. 1.3 _Nucleic Acid Libraries_ (Aptamers) 1.3.1 Jack Szostak at Harvard medical school? 1.3.2 NEXUS corporation (Larry Gold)? 1.4 _Organic Chemical Libraries_ 1.4.1 Affymax? 1.4.2 Parke-Davis (DIVERSOMERS)? **2) Where can I get anti-phage antibodies?** 2.1 anti-pIII MAb from Michael Tesar mte@venus.gbf-braunschweig.d400.de 2.2 anti-pIII polyclonals from GATC, a German company, FAX +49-7531-57313 TEL +49-7531-57204 2.3 rabbit anti-M13 from Stratagene. 2.4 sheep anti M13 phage sheep anti M13 phage biotinylated 5 Prime - 3 Prime Boulder CO (800)533-5703 **3) How can I make my own libraries?** 3.1 _Phage Libraries_ You can obtain suitable vectors and strains from most of the sources in 1). For phagemid work you can get XL-1 Blue cells from Stratagene and M13K07 helper phage from Pharmacia. 3.2 _Synthetic Peptide Libraries_ 3.2.1 Manual synthesis Houghten's "Tea Bag" method Geysen's "Pin" method Both of these can be adapted to produce either support-bound or soluble libraries. 3.2.2 Automated synthesis Chiron Corporation (Zuckermann) Advanced Chemtech (Commercial robot for 75K sterling) 3.3 _Nucleic Acid Libraries_ 3.3.1 PCR methods 3.4 _Organic Chemical Libraries_ 3.4.1 Manual synthesis 3.4.2 Automated synthesis (Advanced Chemtech) **4) How can I analyse the results of my selection?** 4.1 Insert sequencing (phage libraries) 4.2 Micropanning (Smith and Scott, Methods Enzymol. (1993) 217:228-257) 4.3 Dot-blotting (Felici et al., J. Mol. Biol. (1991) 222:301-310) 4.4 ELISA (Smith and Scott, Methods Enzymol. (1993) 217:228-257) (Dente et al. Gene (1994) 148:7-13) 4.5 Colony immunoscreening (Christian et al. J. Mol. Biol. (1992) 227, 711-718) (Felici et al. Gene (1993) 128, 21-27) 4.5 Plaque immunoscreening (Luzzago et al., Gene (1993) 128:51-57) (Felici et al., Methods Enzymol. (1996) 267:116-129) **5) Are there any World Wide Web (WWW) sites about molreps?** 5.1 http://www.bio.net/ - The BIOSCI web site itself (MOLREPS message archive) 5.2 http://bionmr1.rug.ac.be/chemistry/overview.html - A useful chemistry site 5.3 http://vesta.pd.com/ - Site for the journal MOLECULAR DIVERSITY 5.4 http://www.mrc-cpe.cam.ac.uk/imt-doc/vbase-home-page.html - Immunoglobulin v-gene database 5.5 http://molbio.info.nih.gov/molbio/desk.html - Molecular biologists desk reference 5.6 http://www.Kairos-scientific.com/ - Kairos scientific home page 5.7 http://www-lmmb.ncifcrf.gov/~toms/sequencelogo.html - Tom Schneider's Sequence Logo 5.8 http://www.ebi.ac.uk/ - The European Bioinformatics Institute (EBI) 5.9 http://www.ebi.ac.uk/primers_home.html - PCR primers database at EBI 5.10 http://aminoacid.bri.nrc.ca:1125/ - Database of building blocks for library synthesis 5.11 http://vent.neb.com/neb/phd/phd.html - PHD commercial phage library at New England Biolabs > 5.12 ftp://ftp.netcom.com/pub/qu/quincicc/maxim.html > - Another commercial library source > This link seems to be broken. ------------------------------------------------------------------ Andrew Wallace, Ph.D, Queen's University Belfast, N. Ireland (UK) a.wallace@qub.ac.uk http://www.qub.ac.uk/b&bchem/awpage/wallace.htm From owner-repertoires@net.bio.net Sun Sep 01 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: "Janet Clench, Library, Tel:(39 6)91093220" Newsgroups: bionet.molecules.repertoires Subject: Now here's a little something to get your teeth into after the hols .. Date: 2 Sep 1996 17:20:05 +0100 Lines: 428 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <50f1fl$9n6@mserv1.dl.ac.uk> Original-To: molreps@dl.ac.uk ****************************************************** SUBJECT: Combinatorial & Phage Libraries DATE: July 29, August 5, 12, 19, 26 1996 ****************************************************** Journal of the American Chemical Society 118: 25 (JUN 26 1996) M Pellegrini, RH Ebright Artificial sequence-specific DNA binding peptides: Branched-chain basic regions 5831-5835 Tetrahedron Letters 37: 27 (JUL 1 1996) MF Gordeev, DV Patel, J Wu, EM Gordon Approaches to combinatorial synthesis of heterocycles: Solid phase synthesis of pyridines and pyrido[2,3-d]pyrimidines 4643-4646 Chimia 50: 6 (JUN 1996) RW Armstrong, PA Tempest, JF Cargill Microchip encoded combinatorial libraries: Generation of a spatially encoded library from a pool synthesis 258-260 Science 273: 5274 (JUL 26 1996) JA Wells Hormone mimicry 449-450 Science 273: 5274 (JUL 26 1996) NC Wrighton, FX Farrell, R Chang, AK Kashyap, FP Barbone, LS Mulcahy, DL Johnson, RW Barrett, LK Jolliffe, WJ Dower Small peptides as potent mimetics of the protein hormone erythropoietin 458-463 Analytical Biochemistry 238: 1 (JUN 15 1996) JB Burritt, CW Bond, KW Doss, AJ Jesaitis Filamentous phage display of oligopeptide libraries 1-13 Biochimica et Biophysica Acta - Molecular Basis of Disease 1316: 2 (JUN 7 1996) T Friede, V Gnau, G Jung, W Keilholz, S Stevanovic, HG Rammensee Natural ligand motifs of closely related HLA-DR4 molecules predict features of rheumatoid arthritis associated peptides 85-101 FEBS Letters 388: 2-3 (JUN 17 1996) YE Bruggeman, A Boogert, A Vanhoek, PT Jones, G Winter, A Schots, R Hilhorst Phage antibodies against an unstable hapten: Oxygen sensitive reduced flavin 242-244 Journal of Biological Chemistry 271: 26 (JUN 28 1996) Y Tang, N Jiang, C Parakh, D Hilvert Selection of linkers for a catalytic single-chain antibody using phage display technology 15682-15686 Bioorganic & Medicinal Chemistry Letters 6: 12 (JUN 18 1996) HP Nestler, H Wennemers, R Sherlock, DLY Dong Microautoradiographic identification of receptor-ligand interactions in bead-supported combinatorial libraries 1327-1330 Bioorganic & Medicinal Chemistry Letters 6: 12 (JUN 18 1996) N Bailey, AW Dean, DB Judd, D Middlemiss, R Storer, SP Watson A convenient procedure for the solution phase preparation of 2- aminothiazole combinatorial libraries 1409-1414 AIDS Research and Human Retroviruses 12: 10 (JUL 1 1996) JM Binley, HJ Ditzel, CF Barbas, N Sullivan, J Sodroski, PWHI Parren, DR Burton Human antibody responses to HIV type 1 glycoprotein 41 cloned in phage display libraries suggest three major epitopes are recognized and give evidence for conserved antibody motifs in antigen binding 911-924 Journal of Immunology 157: 2 (JUL 15 1996) Q Dinh, NP Weng, M Kiso, H Ishida, A Hasegawa, DM Marcus High affinity antibodies against Le(x) and sialyl Le(x) from a phage display library 732-738 Journal of Immunology 157: 2 (JUL 15 1996) HJ Ditzel, K Itoh, DR Burton Determinants of polyreactivity in a large panel of recombinant human antibodies from HIV-1 infection 739-749 Journal of Immunology 157: 2 (JUL 15 1996) P Tsui, MA Tornetta, RS Ames, BC Bankosky, S Griego, C Silverman, T Porter, G Moore, RW Sweet Isolation of a neutralizing human RSV antibody from a dominant, non-neutralizing immune repertoire by epitope-blocked panning 772-780 Journal of Immunology 157: 2 (JUL 15 1996) A Sahu, BK Kay, JD Lambris Inhibition of human complement by a C3-binding peptide isolated from a phage-displayed random peptide library 884-891 Journal of Immunological Methods 192: 1-2 (JUN 10 1996) BR Gundlach, KH Wiesmuller, T Junt, S Kienle, G Jung, P Walden Determination of T cell epitopes with random peptide libraries 149-155 Journal of Immunological Methods 193: 2 (JUN 21 1996) P Emanuel, T Obrien, J Burans, BR Dasgupta, JJ Valdes, M Eldefrawi Directing antigen specificity towards botulinum neurotoxin with combinatorial phage display libraries 189-197 Journal of Immunological Methods 193: 1 (JUN 14 1996) JD Chesnut, AR Baytan, M Russell, MP Chang, A Bernard, IH Maxwell, JP Hoeffler Selective isolation of transiently transfected cells from a mammalian cell population with vectors expressing a membrane anchored single- chain antibody 17-27 Gene 172: 2 (JUN 26 1996) IM Lang, CF Barbas, RR Schleef Recombinant rabbit Fab with binding activity to type-1 plasminogen activator inhibitor derived from a phage-display library against human alpha-granules 295-298 Journal of Molecular Biology 260: 1 (JUL 5 1996) P Malik, TD Tarry, LR Gowda, A Langara, SA Petukhov, MF Symmons, LC Welsh, DA Marvin, RN Perham Role of capsid structure and membrane protein processing in determining the size and copy number of peptides displayed on the major coat protein of filamentous bacteriophage 9-21 Drug Discovery Today 1: 5 (MAY 1996) N Terrett Combinatorial chemistry 222 Drug Discovery Today 1: 4 (APR 1996) N Terrett Combinatorial chemistry - The way forward 129 Drug Discovery Today 1: 4 (APR 1996) DV Patel, EM Gordon Applications of small-molecule combinatorial chemistry to drug discovery 134-144 Drug Discovery Today 1: 6 (JUN 1996) R Storer Solution-phase synthesis in combinatorial chemistry: Applications in drug discovery 248-254 Drug Discovery Today 1: 6 (JUN 1996) N Terrett Combinatorial chemistry 266 Drug Discovery Today 1: 6 (JUN 1996) N Terrett Combinatorial chemistry - The way forward (vol 1, pg 129, 1996) 230 Drug Discovery Today 1: 1 (JAN 1996) MJ Sofia Generation of oligosaccharide and glycoconjugate libraries for drug discovery 27-34 Journal of Biological Chemistry 271: 28 (JUL 12 1996) K Muller, FO Gombert, U Manning, F Grossmuller, P Graff, H Zaegel, JF Zuber, F Freuler, C Tschopp, G Baumann Rapid identification of phosphopeptide ligands for SH2 domains - Screening of peptide libraries by fluorescence-activated bead sorting 16500-16505 Nucleic Acids Research 24: 12 (JUN 15 1996) J Hamm Characterisation of antibody-binding RNAs selected from structurally constrained libraries 2220-2227 Protein Engineering 9: 6 (JUN 1996) J Davies, L Riechmann Single antibody domains as small recognition units: Design and in vitro antigen selection of camelized, human VH domains with improved protein stability 531-537 Journal of Experimental Medicine 184: 1 (JUL 1 1996) J Blake, JV Johnston, KE Hellstrom, H Marquardt, LP Chen Use of combinatorial peptide libraries to construct functional mimics of tumor epitopes recognized by MHC class I-restricted cytolytic T lymphocytes 121-130 Nature Biotechnology 14: 7 (JUL 1996) RG Panchal, E Cusack, S Cheley, H Bayley Tumor protease-activated, pore-forming toxins from a combinatorial library 852-856 Gene 172: 1 (JUN 12 1996) N Tsurushita, H Fu, C Warren Phage display vectors for in vivo recombination of immunoglobulin heavy and light chain genes to make large combinatorial libraries 59-63 Gene 172: 1 (JUN 12 1996) FS Wen, YH Tseng Nucleotide sequence of the gene presumably encoding the adsorption protein of filamentous phage phi Lf 161-162 Proceedings of the National Academy of Sciences of the United States of America 93: 14 (JUL 9 1996) XH Cheng, AC Harms, PN Goudreau, TC Terwilliger, RD Smith Direct measurement of oligonucleotide binding stoichiometry of gene V protein by mass spectrometry 7022-7027 Proceedings of the National Academy of Sciences of the United States of America 93: 14 (JUL 9 1996) RA Williamson, D Peretz, N Smorodinsky, R Bastidas, H Serban, I Mehlhorn, SJ Dearmond, SB Prusiner, DR Burton Circumventing tolerance to generate autologous monoclonal antibodies to the prion protein 7279-7282 Proceedings of the National Academy of Sciences of the United States of America 93: 14 (JUL 9 1996) SD Yanofsky, DN Baldwin, JH Butler, FR Holden, JW Jacobs, P Balasubramanian, JP Chinn, SE Cwirla, E Petersbhatt, EA Whitehorn, EH Tate, A Akeson, TL Bowlin, WJ Dower, RW Barrett High affinity type I interleukin 1 receptor antagonists discovered by screening recombinant peptide libraries 7381-7386 Drug Discovery Today 1: 7 (JUL 1996) N Terrett Combinatorial chemistry 308-309 Journal of Medicinal Chemistry 39: 14 (JUL 5 1996) DAM Konings, JR Wyatt, DJ Ecker, SM Freier Deconvolution of combinatorial libraries for drug discovery: Theoretical comparison of pooling strategies 2710-2719 Journal of Medicinal Chemistry 39: 14 (JUL 5 1996) L Wilsonlingardo, PW Davis, DJ Ecker, N Hebert, O Acevedo, K Sprankle, T Brennan, L Schwarcz, SM Freier, JR Wyatt Deconvolution of combinatorial libraries for drug discovery: Experimental comparison of pooling strategies 2720-2726 Journal of Molecular Biology 260: 3 (JUL 19 1996) NM Low, P Holliger, G Winter Mimicking somatic hypermutation: Affinity maturation of antibodies displayed on bacteriophage using a bacterial mutator strain 359-368 Science 273: 5276 (AUG 9 1996) V Brezina, IV Orekhova, KR Weiss Functional uncoupling of linked neurotransmitter effects by combinatorial convergence 806-810 Scientist 10: 14 (JUL 8 1996) MA Gallop Hot papers - Combinatorial chemistry - Applications of combinatorial technologies to drug discovery .1. Background and peptide combinatorial libraries, by M.A. Gallop, R.W. Barrett, W.J. Dower, S.P.A. Fodor, E.M. Gordon and Applications of combinatorial technologies to drug discovery .2. Combinatorial organic synthesis, library screening strategies, and future directions, by E.M. Gordon, R.W. Barrett, W.J. Dower, S.P.A. Fodor, M.A. Gallop 14 Journal of Organic Chemistry 61: 15 (JUL 26 1996) JW Guiles, SG Johnson, WV Murray Solid-phase Suzuki coupling for C-C bond formation 5169-5171 Journal of Organic Chemistry 61: 15 (JUL 26 1996) RS Garigipati, B Adams, JL Adams, SK Sarkar Use of spin echo magic angle spinning H-1 NMR in reaction monitoring in combinatorial organic synthesis (vol 61, pg 2911, 1996) 5190 Synthesis - Stuttgart: 7 (JUL 1996) T Hudlicky, KA Abboud, DA Entwistle, RL Fan, R Maurya, AJ Thorpe, J Bolonick, B Myers Toluene-dioxygenase-mediated cis-dihydroxylation of aromatics in enantioselective synthesis. Iterative glycoconjugate coupling strategy and combinatorial design for the synthesis of oligomers of nor- saccharides, inositols and pseudosugars with interesting molecular properties 897 Tetrahedron Letters 37: 31 (JUL 29 1996) CZ Zhang, AMM Mjalli A combinatorial method for the solid phase synthesis of alpha-amino phosphonates and phosphonic acids 5457-5460 Tetrahedron Letters 37: 30 (JUL 22 1996) JJ Parlow The use of anion exchange resins for the synthesis of combinatorial libraries containing aryl and heteroaryl ethers 5257-5260 Tetrahedron Letters 37: 30 (JUL 22 1996) JM Kim, YZ Bi, SJ Paikoff, PG Schultz The solid phase synthesis of oligoureas 5305-5308 Tetrahedron Letters 37: 30 (JUL 22 1996) JM Kim, TE Wilson, TC Norman, PG Schultz Synthesis of a cyclic urea as a nonnatural biopolymer scaffold 5309-5312 Acta Crystallographica Section A 52: Part 4 (JUL 1 1996) CJ Gilmore Maximum entropy and Bayesian statistics in crystallography: A review of practical applications 561-589 Synlett: 7 (JUL 1996) LF Tietze, A Steinmetz A general and expedient method for the solid-phase synthesis of structurally diverse 1-phenylpyrazolone derivatives 667 Nature Biotechnology 14: 8 (AUG 1996) R Peters, RS Sikorski Combinatorial libraries on the Web 1031 Genetika 32: 6 (JUN 1996) SF Oreshkova, OV Manokhina, LI Puchkova, VE Repin, AA Ilichev Identification and characterization of microorganism strains by the genomic fingerprinting technique with biotinylated phage M13 DNA 740-743 Genetika 32: 6 (JUN 1996) SK Semenova, AL Filenko, VA Vasilev, MI Prosnyak, AA Sevastyanova, AP Ryskov Differentiation of chicken breeds of different origin by polymorphic DNA markers 795-803 Journal of Molecular Biology 260: 5 (AUG 2 1996) R Schmitz, G Baumann, H Gram Catalytic specificity of phosphotyrosine kinases Blk, Lyn, c-Src and Syk as assessed by phage display 664-677 Biochemistry 35: 29 (JUL 23 1996) JM Benevides, TC Terwilliger, S Vohnik, GJ Thomas Raman spectroscopy of the Ff gene V protein and complexes with poly(dA): Nonspecific DNA recognition and binding 9603-9609 Bioorganic & Medicinal Chemistry Letters 6: 13 (JUL 9 1996) AL Smith, CG Thomson, PD Leeson An efficient solid phase synthetic route to 1,3-disubstituted 2,4(1H,3H)-quinazolinediones suitable for combinatorial synthesis 1483-1486 Bioorganic & Medicinal Chemistry Letters 6: 13 (JUL 9 1996) W Bannwarth, J Huebscher, R Barner A new linker for primary amines applicable to combinatorial approaches. 1525-1528 Journal of Investigative Dermatology 107: 2 (AUG 1996) D Neri, PG Natali, H Petrul, P Soldani, MR Nicotra, R Vola, A Rivella, AM Creighton, P Neri, M Mariani Recombinant anti-human melanoma antibodies are versatile molecules 164-170 European Journal of Immunology 26: 7 (JUL 1996) IL Laisney, H Benjamin, M Gefter, AD Strosberg Permissive residues within the minimal epitopes of neutralizing monoclonal antibodies to the V3 loop of HIV-1 1634-1640 Molecular Immunology 33: 6 (APR 1996) S Popov, JG Hubbard, ES Ward A novel and efficient route for the isolation of antibodies that recognise T cell receptor 493-502 Seminars in Virology 7: 4 (AUG 1996) JE Crowe The role of antibodies in respiratory viral immunity 273-283 Trends in Biotechnology 14: 7 (JUL 1996) CF Barbas, DR Burton Selection and evolution of high-affinity human anti-viral antibodies 230-234 Proceedings of the National Academy of Sciences of the United States of America 93: 15 (JUL 23 1996) I Fisch, RE Kontermann, R Finnern, O Hartley, AS Solergonzalez, AD Griffiths, G Winter A strategy of exon shuffling for making large peptide repertoires displayed on filamentous bacteriophage 7761-7766 From owner-repertoires@net.bio.net Sun Sep 01 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: Three studentships available Date: 2 Sep 1996 16:14:04 +0100 Lines: 26 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <50etjs$5k8@mserv1.dl.ac.uk> MIME-Version: 1.0 X-Authentication: none Original-To: molreps@dl.ac.uk Three Visiting Studentships, tenable for two years initially with the =0Apo= ssibility of renewal for a third year, are available for postgraduate =0Are= search in the Colleges of Engineering, Health Sciences and Science & =0AAgr= iculture. Their value is currently 6060 pounds Sterling per annum, plus =0A= exemption from enrolment and tuition fees of the University. Applicants must have at least a 2.1 honours degree (or its equivalent) from= a =0AUniversity other than Queen=D5s, and must have shown aptitude for res= earch or =0Aother original work. Students who have not yet graduated and postgraduate students already =0Are= gistered for a doctorate at any University are ineligible to apply. Application forms are available from the Academic Council Office, The Queen= =D5s =0AUniversity of Belfast, Belfast BT7 1NN, Northern Ireland (UK). The = closing =0Adate is 1st December 1996. Email: joyce.thompson@qub.ac.uk Fax: +44-1232-313537 Tel: +44-1232-245133 ext 3004/5/6 ------------------------------------------------------------------ Andrew Wallace, Ph.D, Queen's University Belfast, N. Ireland (UK) a.wallace@qub.ac.uk http://www.qub.ac.uk/b&bchem/awpage/wallace.htm From owner-repertoires@net.bio.net Sun Sep 01 23:00:00 1996 Path: biosci!PLANTPATH.WISC.EDU!mrs From: mrs@PLANTPATH.WISC.EDU (Mike Sussman) Newsgroups: bionet.molecules.repertoires Subject: Molreps FAQ for September 1996 Date: 2 Sep 1996 07:03:58 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 234 Sender: daemon@net.bio.net Distribution: world Message-ID: <1DFE24B7A68@charon.plantpath.wisc.edu> NNTP-Posting-Host: net.bio.net M O L R E P S F R E Q U E N T L Y A S K E D Q U E S T I O N S ************* ******************* ********* ***************** **1 Where can I obtain libraries?** 1.1 _Phage Libraries_ You can try approaching the following people and organisations: 1.1.1 pIII/6-mer, pIII/15-mer, pVIII-4/15-mer libraries: George Smith, University of Missouri, FAX +1-573-882-0123 1.1.2 pVIII/9-mer, pVIII/9-merCys and pVIII/zinc-finger phagemid libraries: Alessandra Luzzago, IRBM P. Angeletti, luzzago@irbm.it Franco Felici, IRBM P. Angeletti, felici@irbm.it (NON-COMMERCIAL USERS ONLY) 1.1.3 Antibody scFvs with synthetic CDRs: Greg Winter, MRC-LMB Cambridge, gw@mrc-lmb.cam.ac.uk (NON-COMMERCIAL USERS ONLY) 1.1.4 Commercial Sources: Stratagene (Fab fragments in phage lambda) Affymax Pharmacia Cambridge Antibody Technology New England Biolabs (pIII/7-mer). (NEB catalog, p.166). see also this URL -> http://vent.neb.com/neb/phd/phd.html 1.2 _Synthetic Peptide Libraries_ 1.2.1 Commercial Sources: Affymax Chiron Corporation Most of the major peptide companies will custom-synthesise a library to your requirements. 1.3 _Nucleic Acid Libraries_ (Aptamers) 1.3.1 Jack Szostak at Harvard medical school? 1.3.2 NEXUS corporation (Larry Gold)? 1.4 _Organic Chemical Libraries_ 1.4.1 Affymax? 1.4.2 Parke-Davis (DIVERSOMERS)? **2) Where can I get anti-phage antibodies?** 2.1 anti-pIII MAb from Michael Tesar mte@venus.gbf-braunschweig.d400.de 2.2 anti-pIII polyclonals from GATC, a German company, FAX +49-7531-57313 TEL +49-7531-57204 2.3 rabbit anti-M13 from Stratagene. 2.4 sheep anti M13 phage sheep anti M13 phage biotinylated 5 Prime - 3 Prime Boulder CO (800)533-5703 **3) How can I make my own libraries?** 3.1 _Phage Libraries_ You can obtain suitable vectors and strains from most of the sources in 1). For phagemid work you can get XL-1 Blue cells from Stratagene and M13K07 helper phage from Pharmacia. 3.2 _Synthetic Peptide Libraries_ 3.2.1 Manual synthesis Houghten's "Tea Bag" method Geysen's "Pin" method Both of these can be adapted to produce either support-bound or soluble libraries. 3.2.2 Automated synthesis Chiron Corporation (Zuckermann) Advanced Chemtech (Commercial robot for 75K sterling) 3.3 _Nucleic Acid Libraries_ 3.3.1 PCR methods 3.4 _Organic Chemical Libraries_ 3.4.1 Manual synthesis 3.4.2 Automated synthesis (Advanced Chemtech) **4) How can I analyse the results of my selection?** 4.1 Insert sequencing (phage libraries) 4.2 Micropanning (Smith and Scott, Methods Enzymol. (1993) 217:228-257) 4.3 Dot-blotting (Felici et al., J. Mol. Biol. (1991) 222:301-310) 4.4 ELISA (Smith and Scott, Methods Enzymol. (1993) 217:228-257) (Dente et al. Gene (1994) 148:7-13) 4.5 Colony immunoscreening (Christian et al. J. Mol. Biol. (1992) 227, 711-718) (Felici et al. Gene (1993) 128, 21-27) 4.5 Plaque immunoscreening (Luzzago et al., Gene (1993) 128:51-57) (Felici et al., Methods Enzymol. (1996) 267:116-129) **5) Are there any World Wide Web (WWW) sites about molreps?** 5.1 http://www.bio.net/ - The BIOSCI web site itself (MOLREPS message archive) 5.2 http://bionmr1.rug.ac.be/chemistry/overview.html - A useful chemistry site 5.3 http://vesta.pd.com/ - Site for the journal MOLECULAR DIVERSITY 5.4 http://www.mrc-cpe.cam.ac.uk/imt-doc/vbase-home-page.html - Immunoglobulin v-gene database 5.5 http://molbio.info.nih.gov/molbio/desk.html - Molecular biologists desk reference 5.6 http://www.Kairos-scientific.com/ - Kairos scientific home page 5.7 http://www-lmmb.ncifcrf.gov/~toms/sequencelogo.html - Tom Schneider's Sequence Logo 5.8 http://www.ebi.ac.uk/ - The European Bioinformatics Institute (EBI) 5.9 http://www.ebi.ac.uk/primers_home.html - PCR primers database at EBI 5.10 http://aminoacid.bri.nrc.ca:1125/ - Database of building blocks for library synthesis 5.11 http://vent.neb.com/neb/phd/phd.html - PHD commercial phage library at New England Biolabs > 5.12 ftp://ftp.netcom.com/pub/qu/quincicc/maxim.html > - Another commercial library source > This link seems to be broken. ------------------------------------------------------------------ Andrew Wallace, Ph.D, Queen's University Belfast, N. Ireland (UK) a.wallace@qub.ac.uk http://www.qub.ac.uk/b&bchem/awpage/wallace.htm From owner-repertoires@net.bio.net Sun Sep 01 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: Studentships available [repost, sorry] Date: 2 Sep 1996 18:41:27 +0100 Lines: 26 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <50f687$e5a@mserv1.dl.ac.uk> MIME-Version: 1.0 X-Authentication: none Original-To: molreps@dl.ac.uk Three Visiting Studentships, tenable for two years initially with the=20 possibility of renewal for a third year, are available for postgraduate=20 research in the Colleges of Engineering, Health Sciences and Science=20 & Agriculture. Their value is currently 6060 pounds Sterling per=20 annum, plus exemption from enrolment and tuition fees of the=20 University. Applicants must have at least a 2.1 honours degree (or its equivalent)=20 from a University other than Queens, and must have shown aptitude=20 for research or other original work. Students who have not yet=20 graduated and postgraduate students already registered for a doctorate=20 at any University are ineligible to apply. Application forms are available from the Academic Council Office,=20 The Queen=D5s University of Belfast, Belfast BT7 1NN, Northern=20 Ireland (UK). The closing date is 1st December 1996. Email: joyce.thompson@qub.ac.uk Fax: +44-1232-313537 Tel: +44-1232-245133 ext 3004/5/6 ------------------------------------------------------------------ Andrew Wallace, Ph.D, Queen's University Belfast, N. Ireland (UK) a.wallace@qub.ac.uk http://www.qub.ac.uk/b&bchem/awpage/wallace.htm From owner-repertoires@net.bio.net Sun Sep 01 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: Visiting studentships available [repost] Date: 2 Sep 1996 17:35:38 +0100 Lines: 26 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <50f2cq$ahs@mserv1.dl.ac.uk> MIME-Version: 1.0 X-Authentication: none Original-To: molreps@dl.ac.uk Three Visiting Studentships, tenable for two years initially with the =0Apo= ssibility of renewal for a third year, are available for postgraduate =0Are= search in the Colleges of Engineering, Health Sciences and Science & =0AAgr= iculture. Their value is currently 6060 pounds Sterling per annum, plus =0A= exemption from enrolment and tuition fees of the University. Applicants must have at least a 2.1 honours degree (or its equivalent) from= a =0AUniversity other than Queen=D5s, and must have shown aptitude for res= earch or =0Aother original work. Students who have not yet graduated and po= stgraduate =0Astudents already registered for a doctorate at any University= are ineligible =0Ato apply. Application forms are available from the Academic Council Office, The Queen= =D5s =0AUniversity of Belfast, Belfast BT7 1NN, Northern Ireland (UK). The = closing =0Adate is 1st December 1996. Email: joyce.thompson@qub.ac.uk Fax: +44-1232-313537 Tel: +44-1232-245133 ext 3004/5/6 ------------------------------------------------------------------ Andrew Wallace, Ph.D, Queen's University Belfast, N. Ireland (UK) a.wallace@qub.ac.uk http://www.qub.ac.uk/b&bchem/awpage/wallace.htm From owner-repertoires@net.bio.net Mon Sep 02 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Alexy Eroshkin Newsgroups: bionet.molecules.repertoires Subject: Protein Multiple Sequences Editor on IuBio FTP-server Date: 3 Sep 1996 11:32:52 +0100 Organization: State Research Center of Virology & Biotechnology VECTOR Lines: 49 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <50h1gk$8sb@mserv1.dl.ac.uk> Original-To: molreps@dl.ac.uk To: molreps@dl.ac.uk From: eroshkin@vector.nsk.su Subject: Protein Multiple Sequences Editor on IuBio FTP-server Dear All, ProMSED, Protein Multiple Sequences EDitor for MS Win 3.x/95 is available now from IuBIO software library: ftp://iubio.bio.indiana.edu/molbio/ibmpc/promsed1.exe (as self-extracted archive). ProMSED is an easy-to-use application for automatic and manual multiple protein sequences alignment, alignment editing, analysis and printing. Interface and the main functions are similar to Microsoft Word. ProMSED can align complete set of sequences, its subset and any selected block, providing thus flexible tool for sequences analysis, visualization, edition and illustrations preparation. Some features: o reads five sequence formats (NBRF/PIR, Pearson (Fasta), EMBL/SwissProt, Intelligenetics and CLUSTAL) and combines sequences from different files; o automatic multiple sequence alignment with ClustalV algorithm; o single and multiple sequence input and edit; o manual alignment includes sequences grouping, blocks deleting, pasting, etc.; o visual analysis is facilitated by amino amino acid coloring reflecting aa similarity in physico-chemical, mutational and other properties; o option for interactive alignment in selected block, leaving unchanged previously aligned regions; o outputs alignment in two formats, produces publication quality alignments; o loads several protein families into different windows; o a HELP is included. Special thanks to Dr. Desmond Higgins for source code of ClustalV. Demo version has limits on length and number of sequences. Comments, bug reports and suggestions for new features are welcome and should be sent by email to eroshkin@vector.nsk.su. Inquiries can be addressed to: ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ Dr. Alexey Eroshkin Institute of Molecular Biology E.mail: eroshkin@vector.nsk.su State Research Center of Virology and Tel: +7 (3832) - 647774 Biotechnology "Vector" Fax: +7 (3832) - 328831 Koltsovo, Novosibirsk Region 633159 Russia ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ From owner-repertoires@net.bio.net Tue Sep 03 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: [Fwd: Job Offered Phage Display] Date: 4 Sep 1996 15:57:18 +0100 Lines: 74 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <50k5ce$o7r@mserv1.dl.ac.uk> MIME-Version: 1.0 Original-To: molreps@dl.ac.uk --------------6DA72934B2B Content-type: text/plain; charset="us-ascii" Content-transfer-encoding: 7bit Forwarded from bionet.molbio.jobs --------------6DA72934B2B Content-type: text/plain; charset="us-ascii" Content-transfer-encoding: 7bit Subject: Job Offered Phage Display Date: 28 Aug 1996 18:22:49 -0700 From: Rolf Kocherhans Organization: University of Zurich, Switzerland Newsgroups: bionet.jobs.offered Institute of Virology, Veterinary-medical Faculty, University of Zurich Job opportunities At present, two postdoctoral positions are available. Both positions are for one year and can be extended to up to three years. The salaries are set by the Swiss National Science Foundation and amount to approx. sFR. 80'000 (ECU 53'000). We are seeking individuals with a strong background in molecular genetics and /or protein chemistry (quantitative ligand receptor interaction) to achieve the following: Job #1: DC (lineage) specific genes will be identified by monoclonal antibodies (mAb) or other ligands and the cDNA product recognized by the ligand cloned using a recently developed filamentous phage system (see Gene, 137, 69, 1993). cDNA libraries from murine and human DC (DC lines or, freshly isolated) are available and are presently being completed. This position is in the context of an EU grant on dendritic cells (DC); see ; and was advertised in Nature (15th August 1996, vol. 382, classified page 23). Job #2: is on Ig repertoire cloning and on the development of novel peptide libraries. The aim is to obtain improved ligands for any desired molecule or the creation of mimotopes. This postdoctoral position would require construction of libraries and biophysical characterization of the libraries by binding phage to selected antigens or ligands. The work on both positions makes use of the same filamentous phage systems and a close collaboration between the two postdoctoral fellows is expected. For more details and applications please contact: Dr. Mark Suter, Institute of Virology, Winterthurerstrasse 266a CH-8057 Zurich Switzerland Tel: +41 1 635 87 17. Fax: +41 1 635 89 11. mailto:msuter@vetvir.unizh.ch --------------6DA72934B2B-- From owner-repertoires@net.bio.net Tue Sep 03 23:00:00 1996 Path: biosci!agate!howland.erols.net!www.nntp.primenet.com!nntp.primenet.com!arclight.uoregon.edu!news.dacom.co.kr!news.kreonet.re.kr!puma.goldstar.co.kr!news From: "Sangsoo Kim, Ph.D." Newsgroups: bionet.molecules.repertoires Subject: C2 diversity vs UNITY Date: Wed, 04 Sep 1996 19:19:36 +0900 Organization: LG Chem. ltd Lines: 14 Message-ID: <322D57B8.2A53@twins.lgchem.co.kr> NNTP-Posting-Host: 165.186.22.135 Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0 (Win95; I) Can anybody give me comparison of the C2 diversity package vs the Tripos UNITY approach ? I would use this information in purchasing CombiChem software. Thanks, -- Sangsoo Kim, Ph.D. Title : Principal Scientist Affil : LG Chem., ltd. Dept. : Biotech Res. Inst. Addr. : Yu-Seong P.O.Box 61 City : Dae-jeon 305-600, KOREA Tel : +82-42-866-2155 FAX : +82-42-862-0331~2 E-mail: ssk@twins.lgchem.co.kr From owner-repertoires@net.bio.net Wed Sep 04 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: post doc on phage display Date: 5 Sep 1996 18:19:43 +0100 Lines: 25 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <50n23f$4ap@mserv1.dl.ac.uk> Original-Sender: awallace@uk.ac.qub MIME-Version: 1.0 X-Authentication: none Original-To: molreps@dl.ac.uk A postdoc to work on novel applications of phage display is available immediately in the laboratory of Dr. Andrew Bradbury, ICGEB, Trieste, Italy. The stipend is 2.200.000 ITL per month (about $1500) net of tax. It is for one year renewable for a second. The closing date for applications is 15 October and the post must be taken up by the end of the year. Please get in touch with me: bradbury@icgeb.trieste.it for further details. Andrew Bradbury SISSA c/o ICGEB Area di Ricerca Padriciano 99 Trieste 34012 Italy Tel +39 40 398995 Fax +39 40 398991 From owner-repertoires@net.bio.net Sun Sep 08 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Alexy Eroshkin Newsgroups: bionet.molecules.repertoires Subject: ANNOUNCE ProAnalyst -- new software for protein/peptide analysis Date: 9 Sep 1996 11:57:35 +0100 Organization: State Research Center of Virology & Biotechnology VECTOR Lines: 112 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <510t6v$j4o@mserv1.dl.ac.uk> Original-To: molreps@dl.ac.uk To: molreps@dl.ac.uk From: eroshkin@vector.nsk.su Subject: ANNOUNCE ProAnalyst - new software for protein/peptide analysis --------------------------------------- ProAnalyst - PROTEIN ANALYST (ver 1.02) --------------------------------------- State Research Center of Virology and Biotechnology Koltsovo, Novosibirsk Region, 633159 Russia and Vladimir Ivanisenko with Alexey Eroshkin are pleased to announce the availability of an easy-to-use, state-of-the-art MS-DOS application designed to solve traditional and new tasks of protein science. ProAnalyst FEATURES: - includes intuitive user interface to facilitate data analysis; - inputs single and multiple protein sequences, activity/property/ genotype data, protein 3D structures; - relates experimental data to protein primary and tertiary structure; - finds sites influencing protein activity/property; - finds relationships between protein sites' characteristics (hydrophobicity, amphipathicity, etc.) and protein activities; - investigates differences between proteins divided by functional, evolutionary or other criteria (for example, relates genotype to phenotype); - investigates physico-chemical factors related with activity changes in a set of mutant proteins (including multiple physico-chemical factors); - simulates protein-engineering experiments and predicts activity of mutant protein; - searches motifs and patterns in combinatorial libraries (peptide and phage-displayed libraries); - provides linear correlation and multiple linear regression analysis, discriminant, ANOVA and alphabetical analysis; - classic profile/plot analysis for a single sequence (hydrophobicity, helical amphipathicity, etc.) suplemented with average, min, max and dispresion plots for a set of sequences; - searches regions with high and low variability of physico-chemical characteristics; - calculates structure-activity correlation profile; - performs cross and inter-group variability analysis based on several matrices of amino acid similarity; - main part of methods works with sequential and spatial sites; - maps obtained results onto 3D structure; - sorts sequences by activity, group number, motifs found; - visualizes multiple alignments and protein 3D structures (stereo) with sites highlighted; - has data converter from several protein sequence formats (FASTA, SWISS-PROT, CLUSTAL, PIR, IG); - has data bases with 50 aligned protein families, more than 60 amino acid properties, HELP, Manual and examples with program applications. ProAnalyst MAY BE USEFUL: - for chemists and biochemists making investigations of protein structure-function and structure-activity analysis; - for protein engineers trying to improve some protein properties; - for molecular biologists that need to get sense from multiple protein alignments and to analyze complicated combinatorial libraries; - for geneticists studying phenotype-genotype correlations; - for those who need color protein 3D pictures with sites highlighted; - for students in any field of PROTEIN SCIENCE; - for those who interested in comparative protein sequence analysis. PUBLICATIONS: 1. Eroshkin A.M., Zhilkin P.A., Fomin V.I. Algorithm and computer program PROANAL for analysis of relationship between structure and activity in a family of proteins or peptides. CABIOS, 1993, 9, 491-497. 2. Eroshkin A.M., Minenkova O.O., Fomin V.A., Ivanisenko V.A., Ilyichev A.A. Analysis of peptide fragment insertions into major coat protein of bacteriophages M13, f1 and fd. Relation of protein structural characteristics and viability of mutant phages. Molec. Biology (Russia), 1993, 27, 1345-1355. 3. Eroshkin A.M., Fomin V.I., Zhilkin P.A., Ivanisenko V.A., Kondrakhin Y.V. PROANAL version 2: multifunctional program for analysis of multiple protein sequence alignments and studying structure-activity relationships in protein families. CABIOS, 1995, 11, 39-44. 4. Kuzmicheva G.A., Kuvshinov V.N., Razumov I.A., Ivanisenko V.A., Eroshkin A.M., et al. Mapping of group specific hemagglutinating antigenic epitope of alphavirus envelope protein E2 using phage display. Doklady Academii Nauk RAN, in press. 5. Morozov B.M., Ivanisenko V.A., Eroshkin A.M., Ugarova N.N. Analysis of relations between bioluminescence color and the structure of beetle luciferases: identification of the sites influencing bioluminescence color. Molec. Biology (Russia), in press. AVAILABILITY: ProAnalyst is available from EBI software library: ftp://ftp.ebi.ac.uk/pub/software/dos/proanalyst/ (as self-extracted archive). Current version works with up to 15 sequences. The length of sequences must be less than or equal to 5000. Comments, bug reports, suggestions for new features are welcome and should be sent by e-mail to: salex@vector.nsk.su (Vladimir Ivanisenko) or eroshkin@vector.nsk.su (Alexey Eroshkin) ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ Dr. Alexey Eroshkin Institute of Molecular Biology E.mail: eroshkin@vector.nsk.su State Research Center of Virology and Tel: +7 (3832) - 647774 Biotechnology "Vector" Fax: +7 (3832) - 328831 Koltsovo, Novosibirsk Region 633159 Russia ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ From owner-repertoires@net.bio.net Sat Sep 14 23:00:00 1996 Path: biosci!bloom-beacon.mit.edu!eru.mt.luth.se!www.nntp.primenet.com!nntp.primenet.com!howland.erols.net!EU.net!main.Germany.EU.net!fu-berlin.de!zrz.TU-Berlin.DE!news.tu-chemnitz.de!News.HTWM.De!news.HRZ.HAB-Weimar.DE!news.uni-jena.de!news.uni-leipzig.de!mlucom4.urz.uni-halle.de!newsmaster From: gerald.boehm@biochemtech.uni-halle.de (Gerald Boehm) Newsgroups: bionet.molecules.repertoires Subject: Postdoc available Phage Display / Protein Chemistry Date: Fri, 13 Sep 1996 22:56:53 GMT Organization: University Halle, Germany Lines: 42 Message-ID: <51bpas$pfr@mlucom4.urz.uni-halle.de> Reply-To: rudolph@biochemtech.uni-halle.de NNTP-Posting-Host: bt-604a.biochemtech.uni-halle.de X-Newsreader: Forte Free Agent 1.0.82 Postdoctoral position available: Structure-based Phage Display / new scaffold molecules ============================================= This position (BAT-O IIa) is available immediately, for two years. The topic of the work is "Structure-based phage display: construction and characterization of a combinatorial protein library on the basis of novel scaffold molecules". Work incluces (i) generation of constructs for phage display, (ii) expression and purification of the proteins, (iii) phage display and panning, (iv) biochemical and physicochemical characterization of the purified proteins and analysis of the library. All neccessary instrumentation (fermentation, chromatographies, DNA-sequencing, etc.) are available. Knowledge: Ph.D. in biochemistry or biology. Interest in protein chemistry and the structure and folding of proteins. Basic molecular biological techniques (cloning, mutagenesis, analysis) and basic biochemical methods should be familiar. Contact: Prof. Dr. Rainer Rudolph (rudolph@biochemtech.uni-halle.de) Dr. Gerald Boehm (gerald.boehm@biochemtech.uni-halle.de) Institut fuer Biotechnologie Martin-Luther-Universitaet Halle-Wittenberg Kurt-Mothes-Strasse 3 D-06120 Halle (Saale), Germany Fax: +345 55 27013 Internet: http://www.biochemtech.uni-halle.de/proteintech (see Internet pages for more information about the institute and the research) From owner-repertoires@net.bio.net Sun Sep 15 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: Re: EMBO course on phage display Date: 16 Sep 1996 17:21:13 +0100 Lines: 90 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <51jupp$7mf@mserv1.dl.ac.uk> Original-Sender: awallace@uk.ac.qub MIME-Version: 1.0 X-Authentication: none Original-To: emerton Dear Elisabeth et al, The course will take place in Trieste, Italy, in the laboratory of Dr. Andrew Bradbury at the International Centre for Genetic Engineering and Biotechnology so you should fill in the application form below and send it to him. The course costs 500,000 Italian Lire per student which must be paid in advance once your application has been accepted by the organisers. Students from EMBO/ICGEB member countries are usually given priority consideration over students from non-member countries. Industrial participants must pay in addition to this, 1500 Ecu (ITL 3,191,280 or US$ 1971.98) directly to the EMBO head office. The cost includes all accomodation and meals as well as the course costs. RETURN APPLICATION FORM TO: Dr. Andrew Bradbury SISSA c/o ICGEB Area di Ricerca Padriciano 99 Trieste 34012 Italy Tel: +39-40-398995 Fax: +39-40-398991 bradbury@icgeb.trieste.it EMBO/ICGEB Phage Display Course: Application form To be returned to A. Bradbury by 15 September. Tick appropriate spaces and type or write clearly Name, Institute and address Telephone Fax email Age Tenured position Post-doctoral Ph.D. student Nationality (member) EMBO ICGEB Research experience Title of the ten minute talk you will give How will this course benefit your research? What you will be able to offer other course members? Two best publications Would you like to bring a sample? and if so what is the sample you would like to bring? From owner-repertoires@net.bio.net Mon Sep 16 23:00:00 1996 Path: biosci!NMSU.EDU!dkim From: dkim@NMSU.EDU ("D. KIM") Newsgroups: bionet.molecules.repertoires Subject: CsCl pellet of filamentous phage Date: 17 Sep 1996 11:17:23 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 11 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Hi. I can find the density specifics for pelleting Lambda phage through a CsCl cushion, but not for filamentous phage. Are the numbers different? Can someone tell me how to pellet filamentous phage through CsCl? Thank you. Daniel Kim dkim@nmsu.edu From owner-repertoires@net.bio.net Mon Sep 16 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: "Janet Clench, Library, Tel:(39 6)91093220" Newsgroups: bionet.molecules.repertoires Subject: seek and you will find ... Date: 17 Sep 1996 14:23:16 +0100 Lines: 273 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <51m8o4$hn9@mserv1.dl.ac.uk> Original-To: molreps@dl.ac.uk ******************************************************* SUBJECT: Combinatorial & Phage Libraries DATE: 2,9,16 September 1996 ******************************************************* Helvetica Chimica Acta 79: 5 (1996) G Quinkert, H Bang, D Reichert Variation and selection 1260-1278 Scientist 10: 16 (AUG 19 1996) JD Keene The first combinatorial library 13 Tetrahedron Letters 37: 34 (AUG 19 1996) XD Cao, AMM Mjalli Combinatorial method for the synthesis of alpha-hydroxy phosphonates on Wang resin 6073-6076 Tetrahedron Letters 37: 34 (AUG 19 1996) M Renil, M Meldal POEPOP and POEPS: Inert polyethylene glycol crosslinked polymeric supports for solid synthesis 6185-6188 Angewandte Chemie - International Edition in English 35: 13-14 (JUL 26 1996) M Maletic, H Wennemers, DQ Mcdonald, R Breslow, WC Still Selective binding of the dipeptides L-Phe-D-Pro and D-Phe-L-Pro to beta-cyclodextrin 1490-1492 Journal of the American Chemical Society 118: 32 (AUG 14 1996) TL Hendrickson, JR Spencer, M Kato, B Imperiali Design and evaluation of potent inhibitors of asparagine-linked protein glycosylation 7636-7637 Tetrahedron Letters 37: 33 (AUG 12 1996) S Hanessian, RY Yang Solution and solid phase synthesis of 5-alkoxyhydantoin libraries with a three-fold functional diversity 5835-5838 Journal of the American Chemical Society 118: 31 (AUG 7 1996) TC Norman, NS Gray, JT Koh, PG Schultz A structure-based library approach to kinase inhibitors 7430-7431 Journal of Chemical Information and Computer Sciences 36: 4 (JUL- AUG 1996) NE Shemetulskis, D Weininger, CJ Blankley, JJ Yang, C Humblet Stigmata: An algorithm to determine structural commonalities in diverse datasets 862-871 Tetrahedron 52: 32 (AUG 5 1996) TW Brandstetter, C Delafuente, YH Kim, RI Cooper, DJ Watkin, NG Oikonomakos, LN Johnson, GWJ Fleet alpha-Azidoesters as divergent intermediates for combinatorial generation of glucofuranose libraries of novel N-linked glycopeptides 10711-10720 Tetrahedron 52: 32 (AUG 5 1996) F Zaragoza, SV Petersen Solid-phase synthesis of substituted 1,2,3-triazoles 10823-10826 Tetrahedron Letters 37: 29 (JUL 15 1996) LH Yang, LQ Guo Pictet-Spengler reaction on solid support. 5041-5044 Tetrahedron Letters 37: 32 (AUG 5 1996) JP Mayer, D Bankaitisdavis, JW Zhang, G Beaton, K Bjergarde, CM Andersen, BA Goodman, CJ Herrera Application of the Pictet-Spengler reaction in combinatorial chemistry. 5633-5636 Tetrahedron Letters 37: 32 (AUG 5 1996) DR Tortolani, SA Biller A solid phase synthesis of miconazole analogs via an iodoetherification reaction 5687-5690 Tetrahedron Letters 37: 32 (AUG 5 1996) SJ Teague Facile synthesis of a o-nitrobenzyl photolabile linker for combinatorial chemistry. 5751-5754 Journal of Biochemistry 120: 2 (AUG 1996) D Luo, N Mah, D Wishart, Y Zhang, F Jacobs, L Martin Construction and expression of bi-functional proteins of single-chain Fv with effector domains 229-232 Journal of Biochemistry 120: 2 (AUG 1996) O Murayama, H Nishida, K Sekiguchi Novel peptide ligands for integrin alpha 6 beta 1 selected from a phage display library 445-451 Journal of Immunological Methods 194: 2 (AUG 14 1996) B Kazemier, H Dehaard, P Boender, B Vangemen, H Hoogenboom Determination of active single chain antibody concentrations in crude periplasmic fractions 201-209 Proceedings of the National Academy of Sciences of the United States of America 93: 17 (AUG 20 1996) PA Rejto, GM Verkhivker Unraveling principles of lead discovery: From unfrustrated energy landscapes to novel molecular anchors 8945-8950 Drug Discovery Today 1: 8 (AUG 1996) J Li CAMD in modern drug discovery 311-312 Medicinal Research Reviews 16: 5 (SEP 1996) JJ Baldwin, I Henderson Recent advances in the generation of small-molecule combinatorial libraries: Encoded split synthesis and solid-phase synthetic methodology 391-405 Biochemistry 35: 32 (AUG 13 1996) RB Spruijt, CJAM Wolfs, JWG Verver, MA Hemminga Accessibility and environment probing using cysteine residues introduced along the putative transmembrane domain of the major coat protein of bacteriophage M13 10383-10391 Biochemistry 35: 32 (AUG 13 1996) M Tsuboi, SA Overman, GJ Thomas Orientation of tryptophan-26 in coat protein subunits of the filamentous virus Ff by polarized Raman microspectroscopy 10403-10410 Biochemistry 35: 32 (AUG 13 1996) A Sato, N Ida, M Fukuyama, K Miwa, J Kazami, H Nakamura Identification from a phage display library of peptides that bind to toxic shock syndrome toxin-1 and that inhibit its binding to major histocompatibility complex (MHC) class II molecules 10441-10447 Biochemistry 35: 32 (AUG 13 1996) KA Williams, CM Deber Biophysical characterization of wild-type and mutant bacteriophage IKe major coat protein in the virion and in detergent micelles 10472-10483 FEBS Letters 391: 1-2 (AUG 5 1996) B Stausbolgron, T Wind, S Kjaer, L Kahns, NJV Hansen, P Kristensen, BFC Clark A model phage display subtraction method with potential for analysis of differential gene expression 71-75 Immunology 88: 4 (AUG 1996) MP Davenport, CL Quinn, P Valsasnini, F Sinigaglia, AVS Hill, JI Bell Analysis of peptide-binding motifs for two disease associated HLA- DR13 alleles using an M13 phage display library 482-486 Immunopharmacology 33: 1-3 (JUN 1996) S Chakravarty, BJ Mavunkel, RR Goehring, DJ Kyle Novel bradykinin receptor antagonists from a structurally directed non-peptide combinatorial library 61-67 Immunopharmacology 33: 1-3 (JUN 1996) D Horwell, M Pritchard, J Raphy, G Ratcliffe 'Targeted' molecular diversity: Design and development of non- peptide antagonists for cholecystokinin and tachykinin receptors 68-72 Biotechnology Progress 12: 4 (JUL-AUG 1996) P Sears, CH Wong Engineering enzymes for bioorganic synthesis: Peptide bond formation 423-433 Journal of Molecular Biology 261: 2 (AUG 16 1996) P Finan, H Koga, MJ Zvelebil, MD Waterfield, S Kellie The C-terminal SH3 domain of p67Ph(phox) binds its natural ligand in a reverse orientation 173-180 Biotechniques 21: 2 (AUG 1996) B Ogretmen, C Carpo, AR Safa Site-directed mutagenesis by unique site elimination using filamentous phage-derived ssDNA templates for plasmids that are resistant to denaturation 209-213 Journal of Biological Chemistry 271: 32 (AUG 9 1996) J Jiracek, A Yiotakis, B Vincent, F Checler, V Dive Development of the first potent and selective inhibitor of the zinc endopeptidase neurolysin using a systematic approach based on combinatorial chemistry of phosphinic peptides 19606-19611 Chemistry & Biology 3: 7 (JUL 1996) AW Schwartz Did minerals perform prebiotic combinatorial chemistry? 515-518 European Journal of Immunology 26: 8 (AUG 1996) A Stryhn, LO Pedersen, T Romme, CH Holm, A Holm, S Buus Peptide binding specificity of major histocompatibility complex class I resolved into an array of apparently independent subspecificities: Quantitation by peptide libraries and improved prediction of binding 1911-1918 Molecular Immunology 33: 7-8 (MAY-JUN 1996) M Ohlin, CAK Borrebaeck Characteristics of human antibody repertoires following active immune responses in vivo 583-592 Journal of Virological Methods 60: 2 (JUL 1996) HS Nagesha, M Yu, LF Wang Application of linker-ligation-PCR for construction of phage display epitope libraries 147-154 Virology 222: 1 (AUG 1 1996) M Yu, LF Wang, BJ Shiell, CJ Morrissy, HA Westbury Fine mapping of a c-terminal linear epitope highly conserved among the major envelope glycoprotein E2 (gp51 to gp54) of different pestiviruses 289-292 Journal of Molecular Biology 261: 1 (AUG 9 1996) P Valadon, G Nussbaum, LF Boyd, DH Margulies, MD Scharff Peptide libraries define the fine specificity of anti-polysaccharide antibodies to Cryptococcus neoformans 11-22 Proceedings of the National Academy of Sciences of the United States of America 93: 16 (AUG 6 1996) J Vagner, G Barany, KS Lam, V Krchnak, NF Sepetov, JA Ostrem, P Strop, M Lebl Enzyme-mediated spatial segregation on individual polymeric support beads: Application to generation and screening of encoded combinatorial libraries 8194-8199 Perspectives in Drug Discovery and Design 3 (1995) A Caflisch, M Karplus Computational combinatorial chemistry for de novo ligand design: Review and assessment 51-84 Physiological Chemistry and Physics and Medical NMR 27: 4 (1995) F Poloni, S Palumbo, M Cianfriglia, F Felici Selection of phage-displayed peptides mimicking an extracellular epitope of human MDR1-P-glycoprotein 271-280 Physiological Chemistry and Physics and Medical NMR 27: 4 (1995) L Dapremont, RM Valerio, AM Bray, KM Stewart, TJ Mason, AW Wang, NJ Maeji Multiple synthesis using the multipin method 339-343 From owner-repertoires@net.bio.net Wed Sep 18 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: 24th EPS highlights Date: 19 Sep 1996 12:37:13 +0100 Lines: 82 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <51rb99$qu0@mserv1.dl.ac.uk> Original-Sender: awallace@uk.ac.qub MIME-Version: 1.0 X-Authentication: none Original-To: molreps@dl.ac.uk Some highlights of the 24th European Peptide Symposium, =0AEdinburgh, 8-13t= h September 1996=0A=0ASpeakers=0A=0AR.E. Offord, University of Geneva, Swit= zerland=0ASelective conjugation of protein fragments using N-terminal aldeh= ydes =0Aand C-terminal hydrazides. Some applications:=0AModifying GCSF JBC = 1994.=0AGaertner, H.F. et al., (1996) Bioconjugate chemistry 7, 38-44.=0AAt= tachment of functionalised PEG to N-terminus:=0AProudfoot, A.E. et al., JBC= 271, 2599-2603 (1996).=0AFluorescent chemokine RANTES derivatives=0ACoupli= ng antibody fragments to enzymes:=0AWerlen, R.C. et al., Bioconjugate chemi= stry 5, 411-417 (1994).=0A=0ARuth Nutt, Corvas International, USA=0ADevelop= ment of Friedinger lactam-contining Argininals as thrombin =0Ainhibitors. D= escribed a conformationally constrained arginine =0Aderivative, 3-piperidyl= -N-guanidino alanine or Ala(PG). Use of this =0Aderivative in the lactam pr= oduced an inhibitor with the highest =0Aselectivity versus trypsin describe= d to date (>100,000).=0A=0AB.P. Roques, CNRS, France=0AHIV infectivity medi= ated by viral nucleocapsid proteins Ncp7 and =0ANcp10, zinc-finger containi= ng proteins. Mutagenesis abolishes =0Ainfectivity. Potential new targets fo= r antiviral therapy.=0A=0AGy Keri, Semmelweis University, Hungary=0ATypes o= f programmed cell death:=0A1. Apoptosis=0A2. Autophagic cytoplasmic vacuola= r=0A3. Non-lysosomal cytoplasmic vacuolar=0ANew kind of Tyr kinase inhibito= r called TT-232 which induces (3) =0Aabove in tumours:=0AD-Phe-Cys-Tyr-D-Tr= p-......-Cys-...=0A=09|_________S-S________|=0Ato be published in PNAS.=0A= =0AJ. Martinez, CNRS Montpellier, France=0ABombesin antagonist fQWAVGH-Sta-= L-NH2, KI =3D 0.75 nM,=0AED50 9.9 =B1 4.1 nmolKg/h.=0AInhibits bombesin-ind= uced 3H-thymidine incorporation into cells.=0A=0AG.L. Amidon, University of= Michigan, USA=0ATransport of dipeptides and small drugs into cells by dipe= ptide =0Atransporter. It is a 7-transmembrane domain (G-coupled?) receptor.= =0AConsensus 7-800 MW limit, anything larger than tripeptides not =0Atrans= ported but not thoroughly studied yet. =A7-lactam antibiotics and =0Aacyclo= vir analogues use this transporter. Rat and human transporters =0Asimilar.= =0A=0AW.A. Gibbons, University of London=0ASynthesis of lipoamino acid anal= ogues to study 7-tm receptors.=0A=0AA. Tartar, Pasteur Institute, France=0A= Inventor of orthogonal library screening techniques. Conclusion: good =0Aid= ea in principle but difficult to use in practice due to complex =0Aresults.= =0A=0AA. Furka, Advanced Chemtech, USA=0AOmission libraries. Interesting bu= t difficult to synthesise without =0Arobotic help.=0A=0AS.L. Feiertag, T=9F= bingen University, Germany=0ACombinatorial head-to-tail cyclised peptide li= braries. Synthesised =0Afragments on chlorotrityl resins, cleaved with mild= TFA treatment =0Athen cyclised in solution and deprotected. Examined diffe= rent =0Acyclisation coupling agents.=0AIle, Thr and Val tend to racemise wh= en C-term. Other AAs < 5%.=0APurity (%)=0AAA=09HATU=09=09TBTU/PPA=0AIle=097= 0=09=0939/30=0APro=0958=09=0938/66=0AThr=0976=09=0925/71=0AVal=0974=09=0956= /35=0A=0ARacemisation (%)=0AAA=09HATU=09=09TBTU/PPA=0AIle=0911=09=0933/38= =0AVal=0911=09=0933/27=0AThr=095=09=0938/9=0A=0ALevels for D-aas were lower= ..=0AHigh racemisation rates caused by slow coupling. HATU superior due to=0Afast coupl= ing. Acetic acid in solvent mix caused acetylation upon =0Acleavage from Tr= ityl resin. Use hexafluoroisopropanol as alternative =0Asolvent.=0AH, P or = N in sequence determine type of side reaction.=0A=0AS. Kent, Scripps Instit= ute, San Diego, California=0ADescribed work on protein signature analysis m= ethod, to be published =0Asoon in Science or PNAS I think.=0A=0APosters=0A= =0A216. Gene transfer method using oligopeptides. H. Aoyagi et al., =0ANaga= saki University, Japan.=0AThe following peptides were found to be efficient= DNA packaging and =0Atransfection agents:=0A46=09Ac-LARL-LARL-LARL-LRAL-LR= AL-LRAL-NHCH3=0A46S=09Ac-LARS-LARS-LSRL-LRSL-SRAL-SRAL-NHCH3=0A46P=09Ac-LAR= L-LARL-LARP-PRAL-LRAL-LRAL-NHCH3=0A=0A331. Biological effects of short =A7-= amyloid fragments. B. Penke et =0Aal., Albert Szent-Gyorgi Medical Universi= ty, Hungary.=0AEffect of amyloid on fluorescence changes over 8 hours, pote= ntial =0Atest for antagonists. Cells were loaded with various fluorescent = =0Adyes:=0AFura-2 (increased F when [Ca2+] increases), with amyloid increas= ed F.=0Adis-C3-3 (lipophillic cation, increased F when taken up by cells), = =0Awith amyloid caused decreased F.=0ABCECF (increased F when intracellular= pH increases), with amyloid =0Acaused decreased F.=0AMeasured effects with= A=A725-35 and different antagonists, but didn=D5t =0Ashow their structures= ..=0A=0A388. Coating of glassy carbon substrates with laminin-derived =0Apep= tides for selective neuronal cell attachment. S. Kienle et al., =0AInstitut= e of organic chemistry, University of T=9Fbingen, Germany=0ASequence=09=09C= hain, Domain, Position=09=09Effect=0A=0ASRARKQAASIKVAVSADR=09A,I,2091-2108= =09=09Adhesion, growth=0ARNIAEIIKDA=09=09B2,I,1542-1551=09=09Neurite growth= =0ASIKVAV=09=09=09A,I,2099-2104=09=09Adhesion, growth=0AYFQRYLI=09=09=09A,I= I,1583-1589=09=09Adhesion, growth=0ACDPGYIGSR=09=09B1,III,925-933=09=09Adhe= sion=0APDSGR=09=09=09B1,III,902-906=09=09Adhesion=0AGTFALRGDNPQ=09=09A,1143= -1153=09=09RGD sequence=0AGNTVPDDDNNQVV=09=09B1,645-657=09=09non-active=0A= =0A390. Cellular uptake of peptides. J. Oehlke et al., Institute of =0Amole= cular pharmacology, Berlin, Germany.=0AFluorescent derivatives of mast cell= activating peptides:=0A=0AH-RPRPQQFOrn(Fluor)GLM-NH2 and=0AH-rprpqqfOrn(Fl= uor)glm-NH2=0A=0Across membranes and interact with G-proteins. Cells become= =0Afluorescent after one minute.=0ACited:=0ABarja, P., Alavi-Nassab, A., T= urck, C.W. and Freire-Moar, J., (1994) =0ACell Immunol. 153, 28.=0ALin, Y.Z= .. et ...Havinger, J., (1995) JBC 270, 14255.=0A=0A-------------------------= -----------------------------------------=0AAndrew Wallace, Ph.D, Queen's = University Belfast, N. Ireland (UK)=0Aa.wallace@qub.ac.uk http://www.qub= ..ac.uk/b&bchem/awpage/wallace.htm=0A From owner-repertoires@net.bio.net Wed Sep 18 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: 24th EPS again, sorry Date: 19 Sep 1996 15:28:34 +0100 Lines: 81 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <51rlai$7aa@mserv1.dl.ac.uk> Original-Sender: awallace@uk.ac.qub MIME-Version: 1.0 X-Authentication: none Original-To: molreps@dl.ac.uk Highlights of the 24th European Peptide Symposium, Edinburgh, 8-13th Septem= ber 1996=0A=0ASpeakers=0A=0AR.E. Offord, University of Geneva, Switzerland= =0ASelective conjugation of protein fragments using N-terminal aldehydes an= d C-terminal hydrazides. Some applications:=0AModifying GCSF JBC 1994.=0AGa= ertner, H.F. et al., (1996) Bioconjugate chemistry 7, 38-44.=0AAttachment o= f functionalised PEG to N-terminus:=0AProudfoot, A.E. et al., JBC 271, 2599= -2603 (1996).=0AFluorescent chemokine RANTES derivatives=0ACoupling antibod= y fragments to enzymes:=0AWerlen, R.C. et al., Bioconjugate chemistry 5, 41= 1-417 (1994).=0A=0ARuth Nutt, Corvas International, USA=0ADevelopment of Fr= iedinger lactam-contining Argininals as thrombin inhibitors. Described a co= nformationally constrained arginine derivative, 3-piperidyl-N-guanidino ala= nine or Ala(PG). Use of this derivative in the lactam produced an inhibitor= with the highest selectivity versus trypsin described to date (>100,000).= =0A=0AB.P. Roques, CNRS, France=0AHIV infectivity mediated by viral nucleoc= apsid proteins Ncp7 and Ncp10, zinc-finger containing proteins. Mutagenesis= abolishes infectivity. Potential new targets for antiviral therapy.=0A=0AG= y Keri, Semmelweis University, Hungary=0ATypes of programmed cell death:=0A= 1. Apoptosis=0A2. Autophagic cytoplasmic vacuolar=0A3. Non-lysosomal cytopl= asmic vacuolar=0ANew kind of Tyr kinase inhibitor called TT-232 which induc= es (3) above in tumours: D-Phe-Cys-Tyr-D-Trp-......-Cys-...=0A=09=09=09|___= __S-S____|=0Ato be published in PNAS.=0A=0AJ. Martinez, CNRS Montpellier, F= rance=0ABombesin antagonist fQWAVGH-Sta-L-NH2, KI =3D 0.75 nM,=0AED50 9.9 = =B1 4.1 nmolKg/h.=0AInhibits bombesin-induced 3H-thymidine incorporation in= to cells.=0A=0AG.L. Amidon, University of Michigan, USA=0ATransport of dipe= ptides and small drugs into cells by dipeptide transporter. It is a 7-trans= membrane domain (G-coupled?) receptor. Consensus 7-800 MW limit, anything l= arger than tripeptides not transported but not thoroughly studied yet. =A7-= lactam antibiotics and acyclovir analogues use this transporter. Rat and hu= man transporters similar.=0A=0AW.A. Gibbons, University of London=0ASynthes= is of lipoamino acid analogues to study 7-tm receptors.=0A=0AA. Tartar, Pas= teur Institute, France=0AInventor of orthogonal library screening technique= s. Conclusion: good idea in principle but difficult to use in practice due = to complex results (we found the same thing at IRBM and had to abandon them= ).=0A=0AA. Furka, Advanced Chemtech, USA=0AOmission libraries. Theoreticall= y interesting but very difficult to synthesise without robotic help.=0A=0AS= ..L. Feiertag, T=9Fbingen University, Germany=0ACombinatorial head-to-tail c= yclised peptide libraries. Synthesised fragments on chlorotrityl resins, cl= eaved with mild TFA treatment then cyclised in solution and deprotected. Ex= amined different cyclisation coupling agents.=0AIle, Thr and Val tend to ra= cemise when C-term. Other AAs < 5%.=0APurity (%)=0AAA=09HATU=09=09TBTU/PPA= =0AIle=0970=09=0939/30=0APro=0958=09=0938/66=0AThr=0976=09=0925/71=0AVal=09= 74=09=0956/35=0A=0ARacemisation (%)=0AAA=09HATU=09=09TBTU/PPA=0AIle=0911=09= =0933/38=0AVal=0911=09=0933/27=0AThr=095=09=0938/9=0A=0ALevels for D-aas were lower.=0A=0AHigh racemisation rat= es caused by slow coupling. HATU superior due to fast coupling. Acetic acid= in solvent mix caused acetylation upon cleavage from Trityl resin. Use hex= afluoroisopropanol as alternative solvent. H, P or N in sequence determine = type of side reaction.=0A=0A=0AS. Kent, Scripps Institute, San Diego, Calif= ornia=0ADescribed work on protein signature analysis method, to be publishe= d soon in Science or PNAS I think.=0A=0APosters=0A=0A216. Gene transfer met= hod using oligopeptides. H. Aoyagi et al., Nagasaki University, Japan.=0ATh= e following peptides were found to be efficient DNA packaging and transfect= ion agents:=0A=0A46=09Ac-LARL-LARL-LARL-LRAL-LRAL-LRAL-NHCH3=0A46S=09Ac-LAR= S-LARS-LSRL-LRSL-SRAL-SRAL-NHCH3=0A46P=09Ac-LARL-LARL-LARP-PRAL-LRAL-LRAL-N= HCH3=0A=0A331. Biological effects of short =A7-amyloid fragments. B. Penke = et al., Albert Szent-Gyorgi Medical University, Hungary.=0AEffect of amyloi= d on fluorescence changes over 8 hours, potential test for antagonists. Cel= ls were loaded with various fluorescent dyes:=0AFura-2 (increased F when [C= a2+] increases), with amyloid increased F.=0Adis-C3-3 (lipophillic cation, = increased F when taken up by cells), with amyloid caused decreased F.=0ABCE= CF (increased F when intracellular pH increases), with amyloid caused decre= ased F.=0AMeasured effects with A=A725-35 and different antagonists, but di= dn=D5t show their structures.=0A=0A388. Coating of glassy carbon substrates= with laminin-derived peptides for selective neuronal cell attachment. S. K= ienle et al., Institute of organic chemistry, University of T=9Fbingen, Ger= many=0ASequence=09=09Chain, Domain, Position=09=09Effect=0A=0ASRARKQAASIKVA= VSADR=09A,I,2091-2108=09=09Adhesion, growth=0ARNIAEIIKDA=09=09B2,I,1542-155= 1=09=09Neurite growth=0ASIKVAV=09=09=09A,I,2099-2104=09=09Adhesion, growth= =0AYFQRYLI=09=09=09A,II,1583-1589=09=09Adhesion, growth=0ACDPGYIGSR=09=09B1= ,III,925-933=09=09Adhesion=0APDSGR=09=09=09B1,III,902-906=09=09Adhesion=0AG= TFALRGDNPQ=09=09A,1143-1153=09=09RGD sequence=0AGNTVPDDDNNQVV=09=09B1,645-6= 57=09=09non-active=0A=0A390. Cellular uptake of peptides. J. Oehlke et al.,= Institute of molecular pharmacology, Berlin, Germany.=0AFluorescent deriva= tives of mast cell activating peptides:=0A=0AH-RPRPQQFOrn(Fluor)GLM-NH2 and= =0AH-rprpqqfOrn(Fluor)glm-NH2=0A=0Across membranes and interact with G-prot= eins. Cells become fluorescent after one minute.=0ACited:=0ABarja, P., Alav= i-Nassab, A., Turck, C.W. and Freire-Moar, J., (1994) Cell Immunol. 153, 28= ..=0ALin, Y.Z. et ...Havinger, J., (1995) JBC 270, 14255.=0A=0A-------------= -----------------------------------------------------=0AAndrew Wallace, Ph.= D, Queen's University Belfast, N. Ireland (UK)=0Aa.wallace@qub.ac.uk ht= tp://www.qub.ac.uk/b&bchem/awpage/wallace.htm=0A From owner-repertoires@net.bio.net Wed Sep 18 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: EPS highlights (repeat, sorry) Date: 19 Sep 1996 13:58:50 +0100 Lines: 137 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <51rg2a$23f@mserv1.dl.ac.uk> Original-Sender: awallace@uk.ac.qub MIME-Version: 1.0 X-Authentication: none Original-To: molreps@dl.ac.uk --Part9609191420.A Content-type: TEXT/PLAIN; CHARSET="US-ASCII" Sorry about this, will try to send it as a text attachment ------------------------------------------------------------------ Andrew Wallace, Ph.D, Queen's University Belfast, N. Ireland (UK) a.wallace@qub.ac.uk http://www.qub.ac.uk/b&bchem/awpage/wallace.htm --Part9609191420.A Content-type: APPLICATION/macwriteii; name="24th EPS Edinburgh - Text" Content-transfer-encoding: BASE64 U29tZSBoaWdobGlnaHRzIG9mIHRoZSAyNHRoIEV1cm9wZWFuIFBlcHRpZGUg U3ltcG9zaXVtLCANRWRpbmJ1cmdoLCA4LTEzdGggU2VwdGVtYmVyIDE5OTYN DVNwZWFrZXJzDQ1SLkUuIE9mZm9yZCwgVW5pdmVyc2l0eSBvZiBHZW5ldmEs IFN3aXR6ZXJsYW5kDVNlbGVjdGl2ZSBjb25qdWdhdGlvbiBvZiBwcm90ZWlu IGZyYWdtZW50cyB1c2luZyBOLXRlcm1pbmFsIGFsZGVoeWRlcyANYW5kIEMt dGVybWluYWwgaHlkcmF6aWRlcy4gU29tZSBhcHBsaWNhdGlvbnM6DU1vZGlm eWluZyBHQ1NGIEpCQyAxOTk0Lg1HYWVydG5lciwgSC5GLiBldCBhbC4sICgx OTk2KSBCaW9jb25qdWdhdGUgY2hlbWlzdHJ5IDcsIDM4LTQ0Lg1BdHRhY2ht ZW50IG9mIGZ1bmN0aW9uYWxpc2VkIFBFRyB0byBOLXRlcm1pbnVzOg1Qcm91 ZGZvb3QsIEEuRS4gZXQgYWwuLCBKQkMgMjcxLCAyNTk5LTI2MDMgKDE5OTYp Lg1GbHVvcmVzY2VudCBjaGVtb2tpbmUgUkFOVEVTIGRlcml2YXRpdmVzDUNv dXBsaW5nIGFudGlib2R5IGZyYWdtZW50cyB0byBlbnp5bWVzOg1XZXJsZW4s IFIuQy4gZXQgYWwuLCBCaW9jb25qdWdhdGUgY2hlbWlzdHJ5IDUsIDQxMS00 MTcgKDE5OTQpLg0NUnV0aCBOdXR0LCBDb3J2YXMgSW50ZXJuYXRpb25hbCwg VVNBDURldmVsb3BtZW50IG9mIEZyaWVkaW5nZXIgbGFjdGFtLWNvbnRpbmlu ZyBBcmdpbmluYWxzIGFzIHRocm9tYmluIA1pbmhpYml0b3JzLiBEZXNjcmli ZWQgYSBjb25mb3JtYXRpb25hbGx5IGNvbnN0cmFpbmVkIGFyZ2luaW5lIA1k ZXJpdmF0aXZlLCAzLXBpcGVyaWR5bC1OLWd1YW5pZGlubyBhbGFuaW5lIG9y IEFsYShQRykuIFVzZSBvZiB0aGlzIA1kZXJpdmF0aXZlIGluIHRoZSBsYWN0 YW0gcHJvZHVjZWQgYW4gaW5oaWJpdG9yIHdpdGggdGhlIGhpZ2hlc3QgDXNl bGVjdGl2aXR5IHZlcnN1cyB0cnlwc2luIGRlc2NyaWJlZCB0byBkYXRlICg+ MTAwLDAwMCkuDQ1CLlAuIFJvcXVlcywgQ05SUywgRnJhbmNlDUhJViBpbmZl Y3Rpdml0eSBtZWRpYXRlZCBieSB2aXJhbCBudWNsZW9jYXBzaWQgcHJvdGVp bnMgTmNwNyBhbmQgDU5jcDEwLCB6aW5jLWZpbmdlciBjb250YWluaW5nIHBy b3RlaW5zLiBNdXRhZ2VuZXNpcyBhYm9saXNoZXMgDWluZmVjdGl2aXR5LiBQ b3RlbnRpYWwgbmV3IHRhcmdldHMgZm9yIGFudGl2aXJhbCB0aGVyYXB5Lg0N R3kgS2VyaSwgU2VtbWVsd2VpcyBVbml2ZXJzaXR5LCBIdW5nYXJ5DVR5cGVz IG9mIHByb2dyYW1tZWQgY2VsbCBkZWF0aDoNMS4gQXBvcHRvc2lzDTIuIEF1 dG9waGFnaWMgY3l0b3BsYXNtaWMgdmFjdW9sYXINMy4gTm9uLWx5c29zb21h bCBjeXRvcGxhc21pYyB2YWN1b2xhcg1OZXcga2luZCBvZiBUeXIga2luYXNl IGluaGliaXRvciBjYWxsZWQgVFQtMjMyIHdoaWNoIGluZHVjZXMgKDMpIA1h Ym92ZSBpbiB0dW1vdXJzOg1ELVBoZS1DeXMtVHlyLUQtVHJwLS4uLi4uLi1D eXMtLi4uDQkgIHxfX19fX19fX19fX1MtU19fX198DXRvIGJlIHB1Ymxpc2hl ZCBpbiBQTkFTLg0NSi4gTWFydGluZXosIENOUlMgTW9udHBlbGxpZXIsIEZy YW5jZQ1Cb21iZXNpbiBhbnRhZ29uaXN0IGZRV0FWR0gtU3RhLUwtTkgyLCBL SSA9IDAuNzUgbk0sDUVENTAgOS45ILEgNC4xIG5tb2xLZy9oLg1JbmhpYml0 cyBib21iZXNpbi1pbmR1Y2VkIDNILXRoeW1pZGluZSBpbmNvcnBvcmF0aW9u IGludG8gY2VsbHMuDQ1HLkwuIEFtaWRvbiwgVW5pdmVyc2l0eSBvZiBNaWNo aWdhbiwgVVNBDVRyYW5zcG9ydCBvZiBkaXBlcHRpZGVzIGFuZCBzbWFsbCBk cnVncyBpbnRvIGNlbGxzIGJ5IGRpcGVwdGlkZSANdHJhbnNwb3J0ZXIuIEl0 IGlzIGEgNy10cmFuc21lbWJyYW5lIGRvbWFpbiAoRy1jb3VwbGVkPykgcmVj ZXB0b3IuIA1Db25zZW5zdXMgNy04MDAgTVcgbGltaXQsIGFueXRoaW5nIGxh cmdlciB0aGFuIHRyaXBlcHRpZGVzIG5vdCANdHJhbnNwb3J0ZWQgYnV0IG5v dCB0aG9yb3VnaGx5IHN0dWRpZWQgeWV0LiCnLWxhY3RhbSBhbnRpYmlvdGlj cyBhbmQgDWFjeWNsb3ZpciBhbmFsb2d1ZXMgdXNlIHRoaXMgdHJhbnNwb3J0 ZXIuIFJhdCBhbmQgaHVtYW4gdHJhbnNwb3J0ZXJzIA1zaW1pbGFyLg0NVy5B LiBHaWJib25zLCBVbml2ZXJzaXR5IG9mIExvbmRvbg1TeW50aGVzaXMgb2Yg bGlwb2FtaW5vIGFjaWQgYW5hbG9ndWVzIHRvIHN0dWR5IDctdG0gcmVjZXB0 b3JzLg0NQS4gVGFydGFyLCBQYXN0ZXVyIEluc3RpdHV0ZSwgRnJhbmNlDUlu dmVudG9yIG9mIG9ydGhvZ29uYWwgbGlicmFyeSBzY3JlZW5pbmcgdGVjaG5p cXVlcy4gQ29uY2x1c2lvbjogZ29vZCANaWRlYSBpbiBwcmluY2lwbGUgYnV0 IGRpZmZpY3VsdCB0byB1c2UgaW4gcHJhY3RpY2UgZHVlIHRvIGNvbXBsZXgg DXJlc3VsdHMuDQ1BLiBGdXJrYSwgQWR2YW5jZWQgQ2hlbXRlY2gsIFVTQQ1P bWlzc2lvbiBsaWJyYXJpZXMuIEludGVyZXN0aW5nIGJ1dCBkaWZmaWN1bHQg dG8gc3ludGhlc2lzZSB3aXRob3V0IA1yb2JvdGljIGhlbHAuDQ1TLkwuIEZl aWVydGFnLCBUn2JpbmdlbiBVbml2ZXJzaXR5LCBHZXJtYW55DUNvbWJpbmF0 b3JpYWwgaGVhZC10by10YWlsIGN5Y2xpc2VkIHBlcHRpZGUgbGlicmFyaWVz LiBTeW50aGVzaXNlZCANZnJhZ21lbnRzIG9uIGNobG9yb3RyaXR5bCByZXNp bnMsIGNsZWF2ZWQgd2l0aCBtaWxkIFRGQSB0cmVhdG1lbnQgDXRoZW4gY3lj bGlzZWQgaW4gc29sdXRpb24gYW5kIGRlcHJvdGVjdGVkLiBFeGFtaW5lZCBk aWZmZXJlbnQgDWN5Y2xpc2F0aW9uIGNvdXBsaW5nIGFnZW50cy4NSWxlLCBU aHIgYW5kIFZhbCB0ZW5kIHRvIHJhY2VtaXNlIHdoZW4gQy10ZXJtLiBPdGhl ciBBQXMgPCA1JS4NUHVyaXR5ICglKQ1BQQlIQVRVCQlUQlRVL1BQQQ1JbGUJ NzAJCTM5LzMwDVBybwk1OAkJMzgvNjYNVGhyCTc2CQkyNS83MQ1WYWwJNzQJ CTU2LzM1DQ1SYWNlbWlzYXRpb24gKCUpDUFBCUhBVFUJCVRCVFUvUFBBDUls ZQkxMQkJMzMvMzgNVmFsCTExCQkzMy8yNw1UaHIJNQkJMzgvOQ0NTGV2ZWxz IGZvciBELWFhcyB3ZXJlIGxvd2VyLg1IaWdoIHJh Y2VtaXNhdGlvbiByYXRlcyBjYXVzZWQgYnkgc2xvdyBjb3VwbGluZy4gSEFU VSBzdXBlcmlvciBkdWUgdG8NZmFzdCBjb3VwbGluZy4gQWNldGljIGFjaWQg aW4gc29sdmVudCBtaXggY2F1c2VkIGFjZXR5bGF0aW9uIHVwb24gDWNsZWF2 YWdlIGZyb20gVHJpdHlsIHJlc2luLiBVc2UgaGV4YWZsdW9yb2lzb3Byb3Bh bm9sIGFzIGFsdGVybmF0aXZlIA1zb2x2ZW50Lg1ILCBQIG9yIE4gaW4gc2Vx dWVuY2UgZGV0ZXJtaW5lIHR5cGUgb2Ygc2lkZSByZWFjdGlvbi4NDVMuIEtl bnQsIFNjcmlwcHMgSW5zdGl0dXRlLCBTYW4gRGllZ28sIENhbGlmb3JuaWEN RGVzY3JpYmVkIHdvcmsgb24gcHJvdGVpbiBzaWduYXR1cmUgYW5hbHlzaXMg bWV0aG9kLCB0byBiZSBwdWJsaXNoZWQgDXNvb24gaW4gU2NpZW5jZSBvciBQ TkFTIEkgdGhpbmsuDQ1Qb3N0ZXJzDQ0yMTYuIEdlbmUgdHJhbnNmZXIgbWV0 aG9kIHVzaW5nIG9saWdvcGVwdGlkZXMuIEguIEFveWFnaSBldCBhbC4sIA1O YWdhc2FraSBVbml2ZXJzaXR5LCBKYXBhbi4NVGhlIGZvbGxvd2luZyBwZXB0 aWRlcyB3ZXJlIGZvdW5kIHRvIGJlIGVmZmljaWVudCBETkEgcGFja2FnaW5n IGFuZCANdHJhbnNmZWN0aW9uIGFnZW50czoNNDYJQWMtTEFSTC1MQVJMLUxB UkwtTFJBTC1MUkFMLUxSQUwtTkhDSDMNNDZTCUFjLUxBUlMtTEFSUy1MU1JM LUxSU0wtU1JBTC1TUkFMLU5IQ0gzDTQ2UAlBYy1MQVJMLUxBUkwtTEFSUC1Q UkFMLUxSQUwtTFJBTC1OSENIMw0NMzMxLiBCaW9sb2dpY2FsIGVmZmVjdHMg b2Ygc2hvcnQgpy1hbXlsb2lkIGZyYWdtZW50cy4gQi4gUGVua2UgZXQgDWFs LiwgQWxiZXJ0IFN6ZW50LUd5b3JnaSBNZWRpY2FsIFVuaXZlcnNpdHksIEh1 bmdhcnkuDUVmZmVjdCBvZiBhbXlsb2lkIG9uIGZsdW9yZXNjZW5jZSBjaGFu Z2VzIG92ZXIgOCBob3VycywgcG90ZW50aWFsIA10ZXN0IGZvciBhbnRhZ29u aXN0cy4gQ2VsbHMgd2VyZSBsb2FkZWQgd2l0aCB2YXJpb3VzIGZsdW9yZXNj ZW50IA1keWVzOg1GdXJhLTIgKGluY3JlYXNlZCBGIHdoZW4gW0NhMitdIGlu Y3JlYXNlcyksIHdpdGggYW15bG9pZCBpbmNyZWFzZWQgRi4NZGlzLUMzLTMg KGxpcG9waGlsbGljIGNhdGlvbiwgaW5jcmVhc2VkIEYgd2hlbiB0YWtlbiB1 cCBieSBjZWxscyksIA13aXRoIGFteWxvaWQgY2F1c2VkIGRlY3JlYXNlZCBG Lg1CQ0VDRiAoaW5jcmVhc2VkIEYgd2hlbiBpbnRyYWNlbGx1bGFyIHBIIGlu Y3JlYXNlcyksIHdpdGggYW15bG9pZCANY2F1c2VkIGRlY3JlYXNlZCBGLg1N ZWFzdXJlZCBlZmZlY3RzIHdpdGggQacyNS0zNSBhbmQgZGlmZmVyZW50IGFu dGFnb25pc3RzLCBidXQgZGlkbid0IA1zaG93IHRoZWlyIHN0cnVjdHVyZXMu DTM4OC4gQ29hdGluZyBvZiBnbGFzc3kgY2FyYm9uIHN1YnN0cmF0ZXMgd2l0 aCBsYW1pbmluLWRlcml2ZWQgDXBlcHRpZGVzIGZvciBzZWxlY3RpdmUgbmV1 cm9uYWwgY2VsbCBhdHRhY2htZW50LiBTLiBLaWVubGUgZXQgYWwuLCANSW5z dGl0dXRlIG9mIG9yZ2FuaWMgY2hlbWlzdHJ5LCBVbml2ZXJzaXR5IG9mIFSf YmluZ2VuLCBHZXJtYW55DVNlcXVlbmNlCQkJQ2hhaW4sIERvbWFpbiwgUG9z aXRpb24JCUVmZmVjdA0NU1JBUktRQUFTSUtWQVZTQURSCUEsSSwyMDkxLTIx MDgJCUFkaGVzaW9uLCBncm93dGgNUk5JQUVJSUtEQQkJCUIyLEksMTU0Mi0x NTUxCQlOZXVyaXRlIGdyb3d0aA1TSUtWQVYJCQlBLEksMjA5OS0yMTA0CQlB ZGhlc2lvbiwgZ3Jvd3RoDVlGUVJZTEkJCQlBLElJLDE1ODMtMTU4OQkJQWRo ZXNpb24sIGdyb3d0aA1DRFBHWUlHU1IJCQlCMSxJSUksOTI1LTkzMwkJQWRo ZXNpb24NUERTR1IJCQkJQjEsSUlJLDkwMi05MDYJCUFkaGVzaW9uDUdURkFM UkdETlBRCQkJQSwxMTQzLTExNTMJCQlSR0Qgc2VxdWVuY2UNR05UVlBERERO TlFWVgkJQjEsNjQ1LTY1NwkJCW5vbi1hY3RpdmUNDTM5MC4gQ2VsbHVsYXIg dXB0YWtlIG9mIHBlcHRpZGVzLiBKLiBPZWhsa2UgZXQgYWwuLCBJbnN0aXR1 dGUgb2YgDW1vbGVjdWxhciBwaGFybWFjb2xvZ3ksIEJlcmxpbiwgR2VybWFu eS4NRmx1b3Jlc2NlbnQgZGVyaXZhdGl2ZXMgb2YgbWFzdCBjZWxsIGFjdGl2 YXRpbmcgcGVwdGlkZXM6DQ1ILVJQUlBRUUZPcm4oRmx1b3IpR0xNLU5IMiBh bmQNSC1ycHJwcXFmT3JuKEZsdW9yKWdsbS1OSDINDWNyb3NzIG1lbWJyYW5l cyBhbmQgaW50ZXJhY3Qgd2l0aCBHLXByb3RlaW5zLiBDZWxscyBiZWNvbWUg DWZsdW9yZXNjZW50IGFmdGVyIG9uZSBtaW51dGUuDUNpdGVkIHRoZSBEZXJv c3NpIHBhcGVyIG9uIHRoZSBBbnRlbm5hcGVkaWEgcGVwdGlkZSBhcyB3ZWxs IGFzOg1CYXJqYSwgUC4sIEFsYXZpLU5hc3NhYiwgQS4sIFR1cmNrLCBDLlcu IGFuZCBGcmVpcmUtTW9hciwgSi4sICgxOTk0KSANQ2VsbCBJbW11bm9sLiAx NTMsIDI4Lg1MaW4sIFkuWi4gZXQgLi4uSGF2aW5nZXIsIEouLCAoMTk5NSkg SkJDIDI3MCwgMTQyNTUuDQ== --Part9609191420.A-- From owner-repertoires@net.bio.net Thu Sep 19 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: 25th EPS Edinburgh Date: 20 Sep 1996 15:33:47 +0100 Lines: 87 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <51ua0b$9cg@mserv1.dl.ac.uk> Original-Sender: awallace@uk.ac.qub MIME-Version: 1.0 X-Authentication: none Original-To: molreps@dl.ac.uk Sorry about this, I'm still trying to work out how to post this text =0Afil= e!=0A=0ASome highlights of the 24th European Peptide Symposium, =0AEdinburg= h, 8-13th September 1996.=0A=0ASpeakers=0A=0AR.E. Offord, University of Gen= eva, Switzerland=0ASelective conjugation of protein fragments using N-termi= nal aldehydes =0Aand C-terminal hydrazides. Some applications:=0AModifying = GCSF JBC 1994.=0AGaertner, H.F. et al., (1996) Bioconjugate chemistry 7, 38= -44.=0AAttachment of functionalised PEG to N-terminus:=0AProudfoot, A.E. et= al., JBC 271, 2599-2603 (1996).=0AFluorescent chemokine RANTES derivatives= =0ACoupling antibody fragments to enzymes:=0AWerlen, R.C. et al., Bioconjug= ate chemistry 5, 411-417 (1994).=0A=0ARuth Nutt, Corvas International, USA= =0ADevelopment of Friedinger lactam-contining Argininals as thrombin =0Ainh= ibitors. Described a conformationally constrained arginine =0Aderivative, 3= -piperidyl-N-guanidino alanine or Ala(PG). Use of this =0Aderivative in the= lactam produced an inhibitor with the highest =0Aselectivity versus trypsi= n described to date (>100,000).=0A=0AB.P. Roques, CNRS, France=0AHIV infect= ivity mediated by viral nucleocapsid proteins Ncp7 and =0ANcp10, zinc-finge= r containing proteins. Mutagenesis abolishes =0Ainfectivity. Potential new = targets for antiviral therapy.=0A=0AGy Keri, Semmelweis University, Hungary= =0ATypes of programmed cell death:=0A1. Apoptosis=0A2. Autophagic cytoplasm= ic vacuolar=0A3. Non-lysosomal cytoplasmic vacuolar=0ANew kind of Tyr kinas= e inhibitor called TT-232 which induces (3) =0Aabove in tumours:=0AD-Phe-Cy= s-Tyr-D-Trp-......-Cys-...=0A=09 |___________S-S____|=0Ato be publish= ed in PNAS.=0A=0AJ. Martinez, CNRS Montpellier, France=0ABombesin antagonis= t fQWAVGH-Sta-L-NH2, KI =3D 0.75 nM,=0AED50 9.9 =B1 4.1 nmolKg/h.=0AInhibit= s bombesin-induced 3H-thymidine incorporation into cells.=0A=0AG.L. Amidon,= University of Michigan, USA=0ATransport of dipeptides and small drugs into= cells by dipeptide =0Atransporter. It is a 7-transmembrane domain (G-coupl= ed?) receptor. =0AConsensus 7-800 MW limit, anything larger than tripeptide= s not =0Atransported but not thoroughly studied yet. =A7-lactam antibiotics= and =0Aacyclovir analogues use this transporter. Rat and human transporter= s =0Asimilar.=0A=0AW.A. Gibbons, University of London=0ASynthesis of lipoam= ino acid analogues to study 7-tm receptors.=0A=0AA. Tartar, Pasteur Institu= te, France=0AInventor of orthogonal library screening techniques. Conclusio= n: good =0Aidea in principle but difficult to use in practice due to comple= x =0Aresults.=0A=0AA. Furka, Advanced Chemtech, USA=0AOmission libraries. I= nteresting but difficult to synthesise without =0Arobotic help.=0A=0AS.L. F= eiertag, T=9Fbingen University, Germany=0ACombinatorial head-to-tail cyclis= ed peptide libraries. Synthesised =0Afragments on chlorotrityl resins, clea= ved with mild TFA treatment =0Athen cyclised in solution and deprotected. E= xamined different =0Acyclisation coupling agents.=0AIle, Thr and Val tend t= o racemise when C-term. Other AAs < 5%.=0APurity (%)=0AAA=09 HATU=09=09TB= TU/PPA=0AIle=09 70=09=09 39/30=0APro=09 58=09=09 38/66=0AThr = 76=09=09 25/71=0AVal=09 74=09=09 56/35=0A=0ARacemisation (%)=0AAA=09 HATU=09=09TBTU/PPA=0AIle=09 11=09=09 3= 3/38=0AVal=09 11=09=09 33/27=0AThr=09 5=09=09 38/9=0A=0ALevels for= D-aas were lower.=0AHigh racemisation rates caused by slow coupling. HATU = superior due to=0Afast coupling. Acetic acid in solvent mix caused acetylat= ion upon =0Acleavage from Trityl resin. Use hexafluoroisopropanol as altern= ative =0Asolvent.=0AH, P or N in sequence determine type of side reaction.= =0A=0AS. Kent, Scripps Institute, San Diego, California=0ADescribed work on= protein signature analysis method, to be published =0Asoon in Science or P= NAS I think.=0A=0APosters=0A=0A216. Gene transfer method using oligopeptide= s. H. Aoyagi et al., =0ANagasaki University, Japan.=0AThe following peptide= s were found to be efficient DNA packaging and =0Atransfection agents:=0A46= =09Ac-LARL-LARL-LARL-LRAL-LRAL-LRAL-NHCH3=0A46S=09Ac-LARS-LARS-LSRL-LRSL-SR= AL-SRAL-NHCH3=0A46P=09Ac-LARL-LARL-LARP-PRAL-LRAL-LRAL-NHCH3=0A=0A331. Biol= ogical effects of short =A7-amyloid fragments. B. Penke et =0Aal., Albert S= zent-Gyorgi Medical University, Hungary.=0AEffect of amyloid on fluorescenc= e changes over 8 hours, potential =0Atest for antagonists. Cells were loade= d with various fluorescent =0Adyes:=0AFura-2 (increased F when [Ca2+] incre= ases), with amyloid increased F.=0Adis-C3-3 (lipophillic cation, increased = F when taken up by cells), =0Awith amyloid caused decreased F.=0ABCECF (inc= reased F when intracellular pH increases), with amyloid =0Acaused decreased= F.=0AMeasured effects with A=A725-35 and different antagonists, but didn't= =0Ashow their structures.=0A388. Coating of glassy carbon substrates with = laminin-derived =0Apeptides for selective neuronal cell attachment. S. Kien= le et al., =0AInstitute of organic chemistry, University of T=9Fbingen, Ger= many=0ASequence Chain, Domain, Position=09=09 Effect=0A= =0ASRARKQAASIKVAVSADR=09 A,I,2091-2108=09=09 Adhesion, gr= owth=0ARNIAEIIKDA=09=09=09 B2,I,1542-1551=09=09 Neur= ite growth=0ASIKVAV=09=09=09 A,I,2099-2104=09=09 = Adhesion, growth=0AYFQRYLI=09=09=09 A,II,1583-1589=09=09 = Adhesion, growth=0ACDPGYIGSR=09=09=09 B1,III,925-933= =09=09 Adhesion=0APDSGR=09=09=09 B1,III,902-906= =09=09 Adhesion=0AGTFALRGDNPQ=09=09 A,1143-1153=09= =09=09 RGD sequence=0AGNTVPDDDNNQVV=09=09 B1,645-657= =09=09=09 non-active=0A=0A390. Cellular uptake of peptides.= J. Oehlke et al., Institute of =0Amolecular pharmacology, Berlin, Germany.= =0AFluorescent derivatives of mast cell activating peptides:=0A=0AH-RPRPQQF= Orn(Fluor)GLM-NH2 and=0AH-rprpqqfOrn(Fluor)glm-NH2=0A=0Across membranes and= interact with G-proteins. Cells become fluorescent after one =0Aminute.=0A= Cited:=0ABarja, P., Alavi-Nassab, A., Turck, C.W. and Freire-Moar, J., (199= 4) =0ACell Immunol. 153, 28.=0ALin, Y.Z. et ...Havinger, J., (1995) JBC 270= , 14255.=0A=0A-------------------------------------------------------------= -----=0AAndrew Wallace, Ph.D, Queen's University Belfast, N. Ireland (UK)= =0Aa.wallace@qub.ac.uk http://www.qub.ac.uk/b&bchem/awpage/wallace.htm= =0A From owner-repertoires@net.bio.net Thu Sep 19 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: 24th EPS Edinburgh (plain text) Date: 20 Sep 1996 15:38:43 +0100 Lines: 96 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <51ua9j$a1h@mserv1.dl.ac.uk> Original-Sender: awallace@uk.ac.qub MIME-Version: 1.0 X-Authentication: none Original-To: molreps@dl.ac.uk --Part9609201559.E Content-type: TEXT/PLAIN; CHARSET="US-ASCII" Trying with a plain text attachment (again, apologies in advance). ------------------------------------------------------------------ Andrew Wallace, Ph.D, Queen's University Belfast, N. Ireland (UK) a.wallace@qub.ac.uk http://www.qub.ac.uk/b&bchem/awpage/wallace.htm --Part9609201559.E Content-type: TEXT/plain; name="EPS Edinburgh" Content-transfer-encoding: QUOTED-PRINTABLE Some highlights of the 24th European Peptide Symposium,=20=0DEdinburgh, 8-1= 3th September 1996.=0D=0DSpeakers=0D=0DR.E. Offord, University of Geneva, S= witzerland=0DSelective conjugation of protein fragments using N-terminal al= dehydes=20=0Dand C-terminal hydrazides. Some applications:=0DModifying GCSF= JBC 1994.=0DGaertner, H.F. et al., (1996) Bioconjugate chemistry 7, 38-44.= =0DAttachment of functionalised PEG to N-terminus:=0DProudfoot, A.E. et al.= , JBC 271, 2599-2603 (1996).=0DFluorescent chemokine RANTES derivatives=0DC= oupling antibody fragments to enzymes:=0DWerlen, R.C. et al., Bioconjugate = chemistry 5, 411-417 (1994).=0D=0DRuth Nutt, Corvas International, USA=0DDe= velopment of Friedinger lactam-contining Argininals as thrombin=20=0Dinhibi= tors. Described a conformationally constrained arginine=20=0Dderivative, 3-= piperidyl-N-guanidino alanine or Ala(PG). Use of this=20=0Dderivative in th= e lactam produced an inhibitor with the highest=20=0Dselectivity versus try= psin described to date (>100,000).=0D=0DB.P. Roques, CNRS, France=0DHIV inf= ectivity mediated by viral nucleocapsid proteins Ncp7 and=20=0DNcp10, zinc-= finger containing proteins. Mutagenesis abolishes=20=0Dinfectivity. Potenti= al new targets for antiviral therapy.=0D=0DGy Keri, Semmelweis University, = Hungary=0DTypes of programmed cell death:=0D1. Apoptosis=0D2. Autophagic cy= toplasmic vacuolar=0D3. Non-lysosomal cytoplasmic vacuolar=0DNew kind of Ty= r kinase inhibitor called TT-232 which induces (3)=20=0Dabove in tumours:= =0DD-Phe-Cys-Tyr-D-Trp-......-Cys-...=0D=09 |___________S-S____|=0Dto= be published in PNAS.=0D=0DJ. Martinez, CNRS Montpellier, France=0DBombesi= n antagonist fQWAVGH-Sta-L-NH2, KI =3D 0.75 nM,=0DED50 9.9 =B1 4.1 nmolKg/h= ..=0DInhibits bombesin-induced 3H-thymidine incorporation into cells.=0D=0DG= ..L. Amidon, University of Michigan, USA=0DTransport of dipeptides and small= drugs into cells by dipeptide=20=0Dtransporter. It is a 7-transmembrane do= main (G-coupled?) receptor.=20=0DConsensus 7-800 MW limit, anything larger = than tripeptides not=20=0Dtransported but not thoroughly studied yet. =A7-l= actam antibiotics and=20=0Dacyclovir analogues use this transporter. Rat an= d human transporters=20=0Dsimilar.=0D=0DW.A. Gibbons, University of London= =0DSynthesis of lipoamino acid analogues to study 7-tm receptors.=0D=0DA. T= artar, Pasteur Institute, France=0DInventor of orthogonal library screening= techniques. Conclusion: good=20=0Didea in principle but difficult to use i= n practice due to complex=20=0Dresults.=0D=0DA. Furka, Advanced Chemtech, U= SA=0DOmission libraries. Interesting but difficult to synthesise without=20= =0Drobotic help.=0D=0DS.L. Feiertag, T=9Fbingen University, Germany=0DCombi= natorial head-to-tail cyclised peptide libraries. Synthesised=20=0Dfragment= s on chlorotrityl resins, cleaved with mild TFA treatment=20=0Dthen cyclise= d in solution and deprotected. Examined different=20=0Dcyclisation coupling= agents.=0DIle, Thr and Val tend to racemise when C-term. Other AAs < 5%.= =0DPurity (%)=0DAA=09 HATU=09=09TBTU/PPA=0DIle=09 70=09=09 39/30=0DPro= =09 58=09=09 38/66=0DThr =0976=09=09 25/71=0DVal=09 74=09=09 56/35=0D= =0DRacemisation (%)=0DAA=09 HATU=09=09TBTU/PPA=0DIle=09 11=09=09 33/38= =0DVal=09 11=09=09 33/27=0DThr=09 5=09=09 38/9=0D=0DLevels for D-aas were lower.=0DHigh racemisation rates caused by s= low coupling. HATU superior due to=0Dfast coupling. Acetic acid in solvent = mix caused acetylation upon=20=0Dcleavage from Trityl resin. Use hexafluoro= isopropanol as alternative=20=0Dsolvent.=0DH, P or N in sequence determine = type of side reaction.=0D=0DS. Kent, Scripps Institute, San Diego, Californ= ia=0DDescribed work on protein signature analysis method, to be published= =20=0Dsoon in Science or PNAS I think.=0D=0DPosters=0D=0D216. Gene transfer= method using oligopeptides. H. Aoyagi et al.,=20=0DNagasaki University, Ja= pan.=0DThe following peptides were found to be efficient DNA packaging and= =20=0Dtransfection agents:=0D46=09Ac-LARL-LARL-LARL-LRAL-LRAL-LRAL-NHCH3=0D= 46S=09Ac-LARS-LARS-LSRL-LRSL-SRAL-SRAL-NHCH3=0D46P=09Ac-LARL-LARL-LARP-PRAL= -LRAL-LRAL-NHCH3=0D=0D331. Biological effects of short =A7-amyloid fragment= s. B. Penke et=20=0Dal., Albert Szent-Gyorgi Medical University, Hungary.= =0DEffect of amyloid on fluorescence changes over 8 hours, potential=20=0Dt= est for antagonists. Cells were loaded with various fluorescent=20=0Ddyes:= =0DFura-2 (increased F when [Ca2+] increases), with amyloid increased F.=0D= dis-C3-3 (lipophillic cation, increased F when taken up by cells),=20=0Dwit= h amyloid caused decreased F.=0DBCECF (increased F when intracellular pH in= creases), with amyloid=20=0Dcaused decreased F.=0DMeasured effects with A= =A725-35 and different antagonists, but didn't=20=0Dshow their structures.= =0D388. Coating of glassy carbon substrates with laminin-derived=20=0Dpepti= des for selective neuronal cell attachment. S. Kienle et al.,=20=0DInstitut= e of organic chemistry, University of T=9Fbingen, Germany=0DSequence = Chain, Domain, Position=09=09 Effect=0D=0DSRARKQAASIKVAVSADR= =09 A,I,2091-2108=09=09 Adhesion, growth=0DRNIAEIIKDA=09= =09=09 B2,I,1542-1551=09=09 Neurite growth=0DSIKVAV= =09=09=09 A,I,2099-2104=09=09 Adhesion, growth= =0DYFQRYLI=09=09=09 A,II,1583-1589=09=09 Adhesion= , growth=0DCDPGYIGSR=09=09=09 B1,III,925-933=09=09 = Adhesion=0DPDSGR=09=09=09 B1,III,902-906=09=09 = Adhesion=0DGTFALRGDNPQ=09=09 A,1143-1153=09=09=09 = RGD sequence=0DGNTVPDDDNNQVV=09=09 B1,645-657=09=09=09 = non-active=0D=0D390. Cellular uptake of peptides. J. Oehlke et al., Ins= titute of=20=0Dmolecular pharmacology, Berlin, Germany.=0DFluorescent deriv= atives of mast cell activating peptides:=0D=0DH-RPRPQQFOrn(Fluor)GLM-NH2 an= d=0DH-rprpqqfOrn(Fluor)glm-NH2=0D=0Dcross membranes and interact with G-pro= teins. Cells become fluorescent after one=20=0Dminute.=0DCited:=0DBarja, P.= , Alavi-Nassab, A., Turck, C.W. and Freire-Moar, J., (1994)=20=0DCell Immun= ol. 153, 28.=0DLin, Y.Z. et ...Havinger, J., (1995) JBC 270, 14255.=0D --Part9609201559.E-- From owner-repertoires@net.bio.net Thu Sep 19 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: 24th EPS Edinburgh (repost, sorry) Date: 20 Sep 1996 15:36:39 +0100 Lines: 136 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <51ua5n$9oa@mserv1.dl.ac.uk> Original-Sender: awallace@uk.ac.qub MIME-Version: 1.0 X-Authentication: none Original-To: molreps@dl.ac.uk --Part9609201538.C Content-type: TEXT/PLAIN; CHARSET="US-ASCII" Trying again to send this as a text attachment ------------------------------------------------------------------ Andrew Wallace, Ph.D, Queen's University Belfast, N. Ireland (UK) a.wallace@qub.ac.uk http://www.qub.ac.uk/b&bchem/awpage/wallace.htm --Part9609201538.C Content-type: APPLICATION/text; name="24th EPS Edinburgh - Text" Content-transfer-encoding: BASE64 U29tZSBoaWdobGlnaHRzIG9mIHRoZSAyNHRoIEV1cm9wZWFuIFBlcHRpZGUg U3ltcG9zaXVtLCANRWRpbmJ1cmdoLCA4LTEzdGggU2VwdGVtYmVyIDE5OTYN DVNwZWFrZXJzDQ1SLkUuIE9mZm9yZCwgVW5pdmVyc2l0eSBvZiBHZW5ldmEs IFN3aXR6ZXJsYW5kDVNlbGVjdGl2ZSBjb25qdWdhdGlvbiBvZiBwcm90ZWlu IGZyYWdtZW50cyB1c2luZyBOLXRlcm1pbmFsIGFsZGVoeWRlcyANYW5kIEMt dGVybWluYWwgaHlkcmF6aWRlcy4gU29tZSBhcHBsaWNhdGlvbnM6DU1vZGlm eWluZyBHQ1NGIEpCQyAxOTk0Lg1HYWVydG5lciwgSC5GLiBldCBhbC4sICgx OTk2KSBCaW9jb25qdWdhdGUgY2hlbWlzdHJ5IDcsIDM4LTQ0Lg1BdHRhY2ht ZW50IG9mIGZ1bmN0aW9uYWxpc2VkIFBFRyB0byBOLXRlcm1pbnVzOg1Qcm91 ZGZvb3QsIEEuRS4gZXQgYWwuLCBKQkMgMjcxLCAyNTk5LTI2MDMgKDE5OTYp Lg1GbHVvcmVzY2VudCBjaGVtb2tpbmUgUkFOVEVTIGRlcml2YXRpdmVzDUNv dXBsaW5nIGFudGlib2R5IGZyYWdtZW50cyB0byBlbnp5bWVzOg1XZXJsZW4s IFIuQy4gZXQgYWwuLCBCaW9jb25qdWdhdGUgY2hlbWlzdHJ5IDUsIDQxMS00 MTcgKDE5OTQpLg0NUnV0aCBOdXR0LCBDb3J2YXMgSW50ZXJuYXRpb25hbCwg VVNBDURldmVsb3BtZW50IG9mIEZyaWVkaW5nZXIgbGFjdGFtLWNvbnRpbmlu ZyBBcmdpbmluYWxzIGFzIHRocm9tYmluIA1pbmhpYml0b3JzLiBEZXNjcmli ZWQgYSBjb25mb3JtYXRpb25hbGx5IGNvbnN0cmFpbmVkIGFyZ2luaW5lIA1k ZXJpdmF0aXZlLCAzLXBpcGVyaWR5bC1OLWd1YW5pZGlubyBhbGFuaW5lIG9y IEFsYShQRykuIFVzZSBvZiB0aGlzIA1kZXJpdmF0aXZlIGluIHRoZSBsYWN0 YW0gcHJvZHVjZWQgYW4gaW5oaWJpdG9yIHdpdGggdGhlIGhpZ2hlc3QgDXNl bGVjdGl2aXR5IHZlcnN1cyB0cnlwc2luIGRlc2NyaWJlZCB0byBkYXRlICg+ MTAwLDAwMCkuDQ1CLlAuIFJvcXVlcywgQ05SUywgRnJhbmNlDUhJViBpbmZl Y3Rpdml0eSBtZWRpYXRlZCBieSB2aXJhbCBudWNsZW9jYXBzaWQgcHJvdGVp bnMgTmNwNyBhbmQgDU5jcDEwLCB6aW5jLWZpbmdlciBjb250YWluaW5nIHBy b3RlaW5zLiBNdXRhZ2VuZXNpcyBhYm9saXNoZXMgDWluZmVjdGl2aXR5LiBQ b3RlbnRpYWwgbmV3IHRhcmdldHMgZm9yIGFudGl2aXJhbCB0aGVyYXB5Lg0N R3kgS2VyaSwgU2VtbWVsd2VpcyBVbml2ZXJzaXR5LCBIdW5nYXJ5DVR5cGVz IG9mIHByb2dyYW1tZWQgY2VsbCBkZWF0aDoNMS4gQXBvcHRvc2lzDTIuIEF1 dG9waGFnaWMgY3l0b3BsYXNtaWMgdmFjdW9sYXINMy4gTm9uLWx5c29zb21h bCBjeXRvcGxhc21pYyB2YWN1b2xhcg1OZXcga2luZCBvZiBUeXIga2luYXNl IGluaGliaXRvciBjYWxsZWQgVFQtMjMyIHdoaWNoIGluZHVjZXMgKDMpIA1h Ym92ZSBpbiB0dW1vdXJzOg1ELVBoZS1DeXMtVHlyLUQtVHJwLS4uLi4uLi1D eXMtLi4uDQkgIHxfX19fX19fX19fX1MtU19fX198DXRvIGJlIHB1Ymxpc2hl ZCBpbiBQTkFTLg0NSi4gTWFydGluZXosIENOUlMgTW9udHBlbGxpZXIsIEZy YW5jZQ1Cb21iZXNpbiBhbnRhZ29uaXN0IGZRV0FWR0gtU3RhLUwtTkgyLCBL SSA9IDAuNzUgbk0sDUVENTAgOS45ILEgNC4xIG5tb2xLZy9oLg1JbmhpYml0 cyBib21iZXNpbi1pbmR1Y2VkIDNILXRoeW1pZGluZSBpbmNvcnBvcmF0aW9u IGludG8gY2VsbHMuDQ1HLkwuIEFtaWRvbiwgVW5pdmVyc2l0eSBvZiBNaWNo aWdhbiwgVVNBDVRyYW5zcG9ydCBvZiBkaXBlcHRpZGVzIGFuZCBzbWFsbCBk cnVncyBpbnRvIGNlbGxzIGJ5IGRpcGVwdGlkZSANdHJhbnNwb3J0ZXIuIEl0 IGlzIGEgNy10cmFuc21lbWJyYW5lIGRvbWFpbiAoRy1jb3VwbGVkPykgcmVj ZXB0b3IuIA1Db25zZW5zdXMgNy04MDAgTVcgbGltaXQsIGFueXRoaW5nIGxh cmdlciB0aGFuIHRyaXBlcHRpZGVzIG5vdCANdHJhbnNwb3J0ZWQgYnV0IG5v dCB0aG9yb3VnaGx5IHN0dWRpZWQgeWV0LiCnLWxhY3RhbSBhbnRpYmlvdGlj cyBhbmQgDWFjeWNsb3ZpciBhbmFsb2d1ZXMgdXNlIHRoaXMgdHJhbnNwb3J0 ZXIuIFJhdCBhbmQgaHVtYW4gdHJhbnNwb3J0ZXJzIA1zaW1pbGFyLg0NVy5B LiBHaWJib25zLCBVbml2ZXJzaXR5IG9mIExvbmRvbg1TeW50aGVzaXMgb2Yg bGlwb2FtaW5vIGFjaWQgYW5hbG9ndWVzIHRvIHN0dWR5IDctdG0gcmVjZXB0 b3JzLg0NQS4gVGFydGFyLCBQYXN0ZXVyIEluc3RpdHV0ZSwgRnJhbmNlDUlu dmVudG9yIG9mIG9ydGhvZ29uYWwgbGlicmFyeSBzY3JlZW5pbmcgdGVjaG5p cXVlcy4gQ29uY2x1c2lvbjogZ29vZCANaWRlYSBpbiBwcmluY2lwbGUgYnV0 IGRpZmZpY3VsdCB0byB1c2UgaW4gcHJhY3RpY2UgZHVlIHRvIGNvbXBsZXgg DXJlc3VsdHMuDQ1BLiBGdXJrYSwgQWR2YW5jZWQgQ2hlbXRlY2gsIFVTQQ1P bWlzc2lvbiBsaWJyYXJpZXMuIEludGVyZXN0aW5nIGJ1dCBkaWZmaWN1bHQg dG8gc3ludGhlc2lzZSB3aXRob3V0IA1yb2JvdGljIGhlbHAuDQ1TLkwuIEZl aWVydGFnLCBUn2JpbmdlbiBVbml2ZXJzaXR5LCBHZXJtYW55DUNvbWJpbmF0 b3JpYWwgaGVhZC10by10YWlsIGN5Y2xpc2VkIHBlcHRpZGUgbGlicmFyaWVz LiBTeW50aGVzaXNlZCANZnJhZ21lbnRzIG9uIGNobG9yb3RyaXR5bCByZXNp bnMsIGNsZWF2ZWQgd2l0aCBtaWxkIFRGQSB0cmVhdG1lbnQgDXRoZW4gY3lj bGlzZWQgaW4gc29sdXRpb24gYW5kIGRlcHJvdGVjdGVkLiBFeGFtaW5lZCBk aWZmZXJlbnQgDWN5Y2xpc2F0aW9uIGNvdXBsaW5nIGFnZW50cy4NSWxlLCBU aHIgYW5kIFZhbCB0ZW5kIHRvIHJhY2VtaXNlIHdoZW4gQy10ZXJtLiBPdGhl ciBBQXMgPCA1JS4NUHVyaXR5ICglKQ1BQQlIQVRVCQlUQlRVL1BQQQ1JbGUJ NzAJCTM5LzMwDVBybwk1OAkJMzgvNjYNVGhyCTc2CQkyNS83MQ1WYWwJNzQJ CTU2LzM1DQ1SYWNlbWlzYXRpb24gKCUpDUFBCUhBVFUJCVRCVFUvUFBBDUls ZQkxMQkJMzMvMzgNVmFsCTExCQkzMy8yNw1UaHIJNQkJMzgvOQ0NTGV2ZWxz IGZvciBELWFhcyB3ZXJlIGxvd2VyLg1IaWdoIHJh Y2VtaXNhdGlvbiByYXRlcyBjYXVzZWQgYnkgc2xvdyBjb3VwbGluZy4gSEFU VSBzdXBlcmlvciBkdWUgdG8NZmFzdCBjb3VwbGluZy4gQWNldGljIGFjaWQg aW4gc29sdmVudCBtaXggY2F1c2VkIGFjZXR5bGF0aW9uIHVwb24gDWNsZWF2 YWdlIGZyb20gVHJpdHlsIHJlc2luLiBVc2UgaGV4YWZsdW9yb2lzb3Byb3Bh bm9sIGFzIGFsdGVybmF0aXZlIA1zb2x2ZW50Lg1ILCBQIG9yIE4gaW4gc2Vx dWVuY2UgZGV0ZXJtaW5lIHR5cGUgb2Ygc2lkZSByZWFjdGlvbi4NDVMuIEtl bnQsIFNjcmlwcHMgSW5zdGl0dXRlLCBTYW4gRGllZ28sIENhbGlmb3JuaWEN RGVzY3JpYmVkIHdvcmsgb24gcHJvdGVpbiBzaWduYXR1cmUgYW5hbHlzaXMg bWV0aG9kLCB0byBiZSBwdWJsaXNoZWQgDXNvb24gaW4gU2NpZW5jZSBvciBQ TkFTIEkgdGhpbmsuDQ1Qb3N0ZXJzDQ0yMTYuIEdlbmUgdHJhbnNmZXIgbWV0 aG9kIHVzaW5nIG9saWdvcGVwdGlkZXMuIEguIEFveWFnaSBldCBhbC4sIA1O YWdhc2FraSBVbml2ZXJzaXR5LCBKYXBhbi4NVGhlIGZvbGxvd2luZyBwZXB0 aWRlcyB3ZXJlIGZvdW5kIHRvIGJlIGVmZmljaWVudCBETkEgcGFja2FnaW5n IGFuZCANdHJhbnNmZWN0aW9uIGFnZW50czoNNDYJQWMtTEFSTC1MQVJMLUxB UkwtTFJBTC1MUkFMLUxSQUwtTkhDSDMNNDZTCUFjLUxBUlMtTEFSUy1MU1JM LUxSU0wtU1JBTC1TUkFMLU5IQ0gzDTQ2UAlBYy1MQVJMLUxBUkwtTEFSUC1Q UkFMLUxSQUwtTFJBTC1OSENIMw0NMzMxLiBCaW9sb2dpY2FsIGVmZmVjdHMg b2Ygc2hvcnQgpy1hbXlsb2lkIGZyYWdtZW50cy4gQi4gUGVua2UgZXQgDWFs LiwgQWxiZXJ0IFN6ZW50LUd5b3JnaSBNZWRpY2FsIFVuaXZlcnNpdHksIEh1 bmdhcnkuDUVmZmVjdCBvZiBhbXlsb2lkIG9uIGZsdW9yZXNjZW5jZSBjaGFu Z2VzIG92ZXIgOCBob3VycywgcG90ZW50aWFsIA10ZXN0IGZvciBhbnRhZ29u aXN0cy4gQ2VsbHMgd2VyZSBsb2FkZWQgd2l0aCB2YXJpb3VzIGZsdW9yZXNj ZW50IA1keWVzOg1GdXJhLTIgKGluY3JlYXNlZCBGIHdoZW4gW0NhMitdIGlu Y3JlYXNlcyksIHdpdGggYW15bG9pZCBpbmNyZWFzZWQgRi4NZGlzLUMzLTMg KGxpcG9waGlsbGljIGNhdGlvbiwgaW5jcmVhc2VkIEYgd2hlbiB0YWtlbiB1 cCBieSBjZWxscyksIA13aXRoIGFteWxvaWQgY2F1c2VkIGRlY3JlYXNlZCBG Lg1CQ0VDRiAoaW5jcmVhc2VkIEYgd2hlbiBpbnRyYWNlbGx1bGFyIHBIIGlu Y3JlYXNlcyksIHdpdGggYW15bG9pZCANY2F1c2VkIGRlY3JlYXNlZCBGLg1N ZWFzdXJlZCBlZmZlY3RzIHdpdGggQacyNS0zNSBhbmQgZGlmZmVyZW50IGFu dGFnb25pc3RzLCBidXQgZGlkbid0IA1zaG93IHRoZWlyIHN0cnVjdHVyZXMu DTM4OC4gQ29hdGluZyBvZiBnbGFzc3kgY2FyYm9uIHN1YnN0cmF0ZXMgd2l0 aCBsYW1pbmluLWRlcml2ZWQgDXBlcHRpZGVzIGZvciBzZWxlY3RpdmUgbmV1 cm9uYWwgY2VsbCBhdHRhY2htZW50LiBTLiBLaWVubGUgZXQgYWwuLCANSW5z dGl0dXRlIG9mIG9yZ2FuaWMgY2hlbWlzdHJ5LCBVbml2ZXJzaXR5IG9mIFSf YmluZ2VuLCBHZXJtYW55DVNlcXVlbmNlCQkJQ2hhaW4sIERvbWFpbiwgUG9z aXRpb24JCUVmZmVjdA0NU1JBUktRQUFTSUtWQVZTQURSCUEsSSwyMDkxLTIx MDgJCUFkaGVzaW9uLCBncm93dGgNUk5JQUVJSUtEQQkJCUIyLEksMTU0Mi0x NTUxCQlOZXVyaXRlIGdyb3d0aA1TSUtWQVYJCQlBLEksMjA5OS0yMTA0CQlB ZGhlc2lvbiwgZ3Jvd3RoDVlGUVJZTEkJCQlBLElJLDE1ODMtMTU4OQkJQWRo ZXNpb24sIGdyb3d0aA1DRFBHWUlHU1IJCQlCMSxJSUksOTI1LTkzMwkJQWRo ZXNpb24NUERTR1IJCQlCMSxJSUksOTAyLTkwNgkJQWRoZXNpb24NR1RGQUxS R0ROUFEJCUEsMTE0My0xMTUzCQkJUkdEIHNlcXVlbmNlDUdOVFZQRERETk5R VlYJCUIxLDY0NS02NTcJCQlub24tYWN0aXZlDQ0zOTAuIENlbGx1bGFyIHVw dGFrZSBvZiBwZXB0aWRlcy4gSi4gT2VobGtlIGV0IGFsLiwgSW5zdGl0dXRl IG9mIA1tb2xlY3VsYXIgcGhhcm1hY29sb2d5LCBCZXJsaW4sIEdlcm1hbnku DUZsdW9yZXNjZW50IGRlcml2YXRpdmVzIG9mIG1hc3QgY2VsbCBhY3RpdmF0 aW5nIHBlcHRpZGVzOg0NSC1SUFJQUVFGT3JuKEZsdW9yKUdMTS1OSDIgYW5k DUgtcnBycHFxZk9ybihGbHVvcilnbG0tTkgyDQ1jcm9zcyBtZW1icmFuZXMg YW5kIGludGVyYWN0IHdpdGggRy1wcm90ZWlucy4gQ2VsbHMgYmVjb21lIGZs dW9yZXNjZW50IGFmdGVyIG9uZSANbWludXRlLg1DaXRlZDoNQmFyamEsIFAu LCBBbGF2aS1OYXNzYWIsIEEuLCBUdXJjaywgQy5XLiBhbmQgRnJlaXJlLU1v YXIsIEouLCAoMTk5NCkgDUNlbGwgSW1tdW5vbC4gMTUzLCAyOC4NTGluLCBZ LlouIGV0IC4uLkhhdmluZ2VyLCBKLiwgKDE5OTUpIEpCQyAyNzAsIDE0MjU1 Lg0= --Part9609201538.C-- From owner-repertoires@net.bio.net Mon Sep 23 23:00:00 1996 Path: biosci!PARADISE1.BERKELEY.EDU!navin From: navin@PARADISE1.BERKELEY.EDU (navin) Newsgroups: bionet.molecules.repertoires Subject: phage ELISA Date: 23 Sep 1996 20:55:24 -0700 Organization: Handel Lab - UC Berkeley Lines: 15 Sender: daemon@net.bio.net Distribution: world Message-ID: <32475BE1.41C6@paradise1.berkeley.edu> NNTP-Posting-Host: net.bio.net Hi Y'all, I tried to do a phage ELISA (detecting phage with anti-M13 antibodies and an HRP-coupled 2' antibody). As a control, I added phage directly to the wells, w/o blocking. After binding them to the wells non-specifically, I blocked with 5mg/ml BSA and proceeded normally. The signal I got from this positive control was equivalent to my negative controls (phage that shouldn't bind plate-bound ligand). Does this mean that phage don't bind well to ELISA plates nonspecifically? Sincerely, Navin navin@paradise1.berkeley.edu From owner-repertoires@net.bio.net Tue Sep 24 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Andrew Wallace Newsgroups: bionet.molecules.repertoires Subject: [Fwd: Phage Display of cytosolic Protein] Date: 25 Sep 1996 16:39:10 +0100 Lines: 58 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <52bjmv$g6i@mserv1.dl.ac.uk> MIME-Version: 1.0 Original-To: molreps@dl.ac.uk --------------497055C9188 Content-type: text/plain; charset="us-ascii" Content-transfer-encoding: 7bit Forwarded from methods and reagents -- ====================================================================== Andrew Wallace,Ph.D., Queen's University Belfast, N. Ireland (UK) a.wallace@qub.ac.uk http://www.qub.ac.uk/b&bchem/awpage/wallace.htm ====================================================================== --------------497055C9188 Content-Disposition: inline Content-type: message/rfc822 Content-transfer-encoding: 7bit Relay-Version: ANU News - V6.1B9 05/16/94 VAX/VMS V5.5-2; site queens-belfast.ac.uk Path: queens-belfast.ac.uk!strath-cs!uknet!usenet2.news.uk.psi.net!uknet!usenet1.news.uk.psi.net!uknet!EU.net!enews.sgi.com!news.sgi.com!news.msfc.nasa.gov!newsfeed.internetmci.com!in3.uu.net!betty.bway.net!news Newsgroups: bionet.molbio.methds-reagnts Subject: Phage Display of cytosolic Protein Message-ID: <32414478.1A7F@bway.net> From: Thomas Weber Date: Thu, 19 Sep 1996 09:02:48 -0400 Reply-To: tomweber@net.bway Organization: bway.net, part of Outernet, Inc. in New York City NNTP-Posting-Host: dial90.bway.net Mime-Version: 1.0 X-Mailer: Mozilla 2.02 (Macintosh; I; 68K) CC: bionet.molbio.proteins@uk.ac.queens-belfast, bionet.cellbiol@uk.ac.queens-belfast Lines: 21 Content-type: text/plain; charset="us-ascii" Content-transfer-encoding: 7bit Hi there, I want to display a cytosolic protein, and thereafter random mutants of it, as a fusion protein with a protein of a filamentous phage, much like petide libraries. Here my questions: has anyone of you out there ever done this and what was your experience with the nonreducing environment that the usually cytosolic proteins are now exposed to ? What is the best vector (phagemid) to use and where can I get it from ? Did any of you ever use the expression module of the Pharmacia Recombinant Phage display Antibody System (RPAS) for a similar purpose, and how are your experiences ? Thanks for your input Thomas --------------497055C9188-- From owner-repertoires@net.bio.net Tue Sep 24 23:00:00 1996 Path: biosci!agate!howland.erols.net!cs.utexas.edu!swrinde!news.sgi.com!news.msfc.nasa.gov!newsfeed.internetmci.com!in3.uu.net!EU.net!Belgium.EU.net!chaos.kulnet.kuleuven.ac.be!news.belnet.be!news.fundp.ac.be!immuno-wawa.sciences.fundp.ac.be!user From: Pascal.Mertens@fundp.ac.be (Pascal Mertens) Newsgroups: bionet.molecules.repertoires Subject: Re: phage ELISA Date: 25 Sep 1996 06:05:14 GMT Organization: Lab. Immunologie, FUNDP Lines: 34 Distribution: world Message-ID: References: <32475BE1.41C6@paradise1.berkeley.edu> NNTP-Posting-Host: immuno-wawa.sciences.fundp.ac.be In article (Dans l'article) <32475BE1.41C6@paradise1.berkeley.edu>, navin@PARADISE1.BERKELEY.EDU (navin) wrote (écrivait) : > Hi Y'all, > > I tried to do a phage ELISA (detecting phage with anti-M13 antibodies > and an HRP-coupled 2' antibody). As a control, I added phage directly to > the wells, w/o blocking. After binding them to the wells > non-specifically, I blocked with 5mg/ml BSA and proceeded normally. > The signal I got from this positive control was equivalent to my > negative controls (phage that shouldn't bind plate-bound ligand). > Does this mean that phage don't bind well to ELISA plates > nonspecifically? > > Sincerely, > > Navin > navin@paradise1.berkeley.edu Hi Navin, Phage does!! For higher binding, use Maxisorb plates. Pascal -- Pascal Mertens Laboratoire d'Immunologie et Microbiologie URBM-FUNDP 61 Rue de Bruxelles 5000 Namur, BELGIUM Phone: 32 81 724438 Fax: 32 81 724420 From owner-repertoires@net.bio.net Thu Sep 26 23:00:00 1996 Path: biosci!BOTANY.UFL.EDU!jshao From: jshao@BOTANY.UFL.EDU Newsgroups: bionet.molecules.repertoires Subject: help with the terminology (PFU, TU, virion) Date: 27 Sep 1996 10:08:00 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 12 Sender: daemon@net.bio.net Distribution: world Message-ID: <199609271707.NAA26383@clas.ufl.edu> NNTP-Posting-Host: net.bio.net Hi, I am wondering what PFU (plaque forming unit),TU (transducing/infectious unit) mean when they are used indicating the amount of phage. I noticed that there are 10-100 folds of difference in numbers between PFU and virions/phage number (how come?), it seems PFU and TU are exchangeable. Virology is not my expertise. I appreciate any clarifications from you. Thanks. Jiahong Shao Dept. of Botany Univ. of Florida From owner-repertoires@net.bio.net Fri Sep 27 23:00:00 1996 Path: biosci!internet!biosci!not-for-mail From: biohelp (BIOSCI Administrator) Newsgroups: bionet.molecules.repertoires Subject: BIOSCI/bionet miniFAQ & Fundraiser Date: 28 Sep 1996 02:00:43 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 239 Sender: daemon@net.bio.net Distribution: world Message-ID: <199609280900.CAA23139@net.bio.net> NNTP-Posting-Host: net.bio.net (LAST REVISION: 30-JUL-95) This BIOSCI "miniFAQ" is designed to answer the questions that come up the *most frequently*. The main BIOSCI FAQ (Frequently Asked Questions) is accessible on the World Wide Web at URL http://www.bio.net/. If you can not find an answer to your question in this or other documentation, the BIOSCI technical support staff answers e-mail queries sent to biosci-help@net.bio.net We can only answer questions about the use of the newsgroups and mailing lists. We unfortunately do not have the staff to do Internet information searches or answer scientific questions. Please post those to the appropriate BIOSCI/bionet newsgroups. Contents: -------- 0) BIOSCI NEEDS YOUR SUPPORT!! 1) Using the WWW to access the BIOSCI/bionet newsgroups. 2) What to do about "spams," i.e., junk mail, ads, etc. 3) Examples of subscribing and unsubscribing to the mailing lists. 4) The BIOSCI user address and research interest directory. 0) BIOSCI NEEDS YOUR SUPPORT!! ------------------------------ BIOSCI's government funding has been expended, and we are now operating solely from advertising revenue that we have raised from our Web site at http://www.bio.net/. We need just a few minutes of your time to help us serve you. You can do two important things which will take very little time for you individually and will immensely help us continue to help you. First, please use our WWW system at http://www.bio.net/ to access the archives. You can post or reply to messages via your Web browser as described in item #1 below. Your usage helps attract sponsors. If you contact any of our sponsors, please be sure to thank them for supporting BIOSCI. It is critical for them to get this feedback if they are to continue their sponsorship for the long term. Second, if you work for a company or organization that provides products or services of interest to the biology community, please pass this message on to your marketing or marketing communications department or other appropriate group. Please ask them to help support BIOSCI by sponsoring our Web site and explain the uses and benefits of the system to the biology community. If they are interested, they can then contact us for further information at our tech support address, biosci-help@net.bio.net. 1) Using the WWW to access the BIOSCI/bionet newsgroups. -------------------------------------------------------- As of 10 December 1995, all BIOSCI/bionet full newsgroups are accessible through the World Wide Web (WWW) at URL http://www.bio.net. One can read and reply publicly or privately to both recent postings and archived messages through one's Web browser if it is configured properly to send e-mail. Each newsgroup is equipped with its own WAIS index. The main BIOSCI home page also has access to the BIO-JOURNALS Table of Contents database WAIS index and the BIOSCI user address database described in another item further below. 2) What to do about "spams," i.e., junk mail, ads, etc. ------------------------------------------------------- BIOSCI is a set of parallel USENET newsgroups (the "bionet" groups), mailing lists, and a hypermail archive at URL http://www.bio.net/. The same postings are distributed on all media (except for a small number of mailing-list-only groups at net.bio.net). Unfortunately it is becoming a despicable practice on the Internet (by a few people out to make a fast buck) to do automated mass postings to thousands of newsgroups and mailing lists. These attempts to grab free advertising are refered to as "spams" in the usual, somewhat boneheaded, net terminology. USENET is more susceptible to this practice, and many spams originate on the USENET groups and then are passed on to the mailing lists. However, spammers also get lists of mailing addresses and hit these too, so neither medium is immune. What should you do personally if you get junk mail? --------------------------------------------------- Just delete it and move on without reading it further. Filing a protest is becoming increasingly useless because spammers are often disguising the addresses where the messages are sent from. Unless you really understand Internet mail systems, your attempt at protest by sending replies to the message will often end up being sent to the address of an innocent person that the spammer is victimizing. What can BIOSCI/bionet do to protect its newsgroups? ---------------------------------------------------- The only solution currently available is to moderate the newsgroup. If this newsgroup is already moderated, then you are in good shape. Moderation protects the USENET distribution from about 95% of the spams that are being sent to date and protects the mailing lists completely. Moderation means, however, that someone has to take the time to review each message before it goes out. We have set up software here that simply allows the moderator to forward to an address at net.bio.net messages that (s)he wishes to have distributed. This takes no more time than that needed to read the message and pass it on, say about 1 min. per message. Most newsgroups currently have a discussion leader who is responsible for their newsgroup. The discussions leaders and their e-mail addresses are listed in the BIOSCI Information Sheet which is available on the Web at http://www.bio.net/. If a newsgroup is being hit with too many junk postings, please contact the discussion leader for that group and see if there is interest in moderating the group. Please do not assume that by simply posting a complaint to the newsgroup itself, anyone on the BIOSCI staff will act on your complaint. With close to 100 newsgroups to run, the BIOSCI staff has to rely on the discussion leaders of each newsgroup to report problems directly to us at biosci-help@net.bio.net. We will moderate any of our newsgroups if the discussion leader tells us that the readership of the group wishes to do so and if a moderator is willing to do the work. For most BIOSCI/bionet groups, this entails only a few minutes of work each day. Moderating a newsgroup will resolve probably 95% of the junk postings on the USENET distribution. Unfortunately there are easy ways for determined spammers to override the moderation mechanism on USENET, but we can protect our e-mail subscribers from unwanted postings if the newsgroup is moderated. You can also access our newsgroups over the WWW at URL http://www.bio.net. While this Web interface will not stop spammers from trying to post to the groups, this will give you yet another way, besides using USENET news, to keep the junk out of your personal mail files. For those of you with local USENET news systems, the Web interface will also give you faster access to new newsgroups and recent postings. 3) Examples of subscribing and unsubscribing to the mailing lists. ------------------------------------------------------------------ PLEASE NOTE: The BIOSCI management does NOT act on subscription/unsubscription requests that are posted improperly to the newsgroups and mailing lists. People who do this only bother everyone on the lists to no avail. Please be sure to follow the proper procedures below. Gory details are in the BIOSCI Information sheets on the Web at http://www.bio.net. Below we give an example utilizing the METHODS-AND-REAGENTS list at both of our two BIOSCI sites: Users in the Americas and Pacific Rim countries who use the BIOSCI ------------------------------------------------------------------ node at computer net.bio.net: ---------------------------- A) Determine the "listname" which is the <=8 character mail address ^^^^^^^^^^^^^ for the group. These can be found in the BIOSCI Info. Sheet. For the METHODS-AND-REAGENTS group the mailing address is methods@net.bio.net. The listname is the portion of the address to the left of the @ sign, i.e., "methods". The listname is used with the "subscribe" and "unsubscribe" commands illustrated below. B) Mail all commands in the body of a mail message addressed to biosci-server@net.bio.net. Do NOT send commands to the newsgroup posting addresses! Leave the Subject: line blank, any text on it will be ignored. C) In the body of your message put one or more of the following commands with an "end" command on the last line, e.g., subscribe methods unsubscribe methods end Do NOT put your e-mail address or other text on these lines. The server only allows you to cancel your subscription if the address on your mail header matches the address on our mailing list. Please ask for help at biosci-help@net.bio.net if your address has changed, e.g., if you know you are on the list but the server tells you that you are not a member. Users in Europe, Africa, and Central Asia who use the BIOSCI node at -------------------------------------------------------------------- computer daresbury.ac.uk (also known as dl.ac.uk): ------------------------------------------------- To subscribe and unsubscribe to/from the BIOSCI lists, you need to specify the full USENET newsgroup name with "bionet-news." prepended. The USENET newsgroup names are listed in the BIOSCI Information sheet on the Web at http://www.bio.net/. For the METHODS-AND-REAGENTS list the USENET newsgroup name is bionet.molbio.methds-reagnts, thus the appropriate commands are sub bionet-news.bionet.molbio.methds-reagnts unsub bionet-news.bionet.molbio.methds-reagnts These commands are included in a message addressed to mxt@dl.ac.uk, NOT to the newsgroup mailing addresses. As usual, include the text in the body of the message as text on the Subject: line is ignored. To unsubscribe from all the lists at the UK node, use unsub bionet-news Please note that if the address in the list is different than the one in your mail message header, you will not be able to unsubscribe by this method. If you have problems, please mail biosci@daresbury.ac.uk. 4) The BIOSCI user address and research interest directory. ----------------------------------------------------------- Please take this opportunity to add your name, address, and research interest information to the BIOSCI User Address Database if you have not already done so. You can fill out the address form directly through our Web page at URL http://www.bio.net/adrform.html. The address database is reindexed nightly for WWW access (the URL is http://www.bio.net/). If you are not directly on the Internet but can reach it by e-mail, please use our waismail server to access the user directory. waismail use is described above. You can also request a user address form by e-mail from biosci-help@net.bio.net. Please check your database entry from time-to-time to see if your address information is still up-to-date. Because of our limited personnel resources, we ask that you resubmit a *complete* form to revise your entry; we only replace complete entries and do not have resources to edit old forms. Sincerely, Dave Kristofferson BIOSCI/bionet Manager biosci-help@net.bio.net From owner-repertoires@net.bio.net Sun Sep 29 23:00:00 1996 Path: biosci!agate!usenet.kornet.nm.kr!news.postech.ac.kr!news.kreonet.re.kr!newsfeed.dacom.co.kr!arclight.uoregon.edu!nntp.primenet.com!cs.utexas.edu!swrinde!news.uh.edu!usenet From: benedik@uh.edu (Michael Benedik) Newsgroups: bionet.molecules.repertoires Subject: Re: help with the terminology (PFU, TU, virion) Date: 30 Sep 1996 15:25:04 GMT Organization: University of Houston Lines: 43 Sender: benedik@menudo.uh.edu. Distribution: world Message-ID: <52ooog$v6l@Masala.CC.UH.EDU> References: <199609271707.NAA26383@clas.ufl.edu> NNTP-Posting-Host: moose.bchs.uh.edu X-Newsreader: InterNews 2.0.1@moose.bchs.uh.edu.[R] X-Authenticated: benedik on POP host menudo.uh.edu. In article <199609271707.NAA26383@clas.ufl.edu> jshao@BOTANY.UFL.EDU writes: > Hi, > I am wondering what PFU (plaque forming unit),TU (transducing/infectious > unit) mean when they are used indicating the amount of phage. > I noticed that there are 10-100 folds of difference in numbers between PFU > and virions/phage number (how come?), it seems PFU and TU are exchangeable. > Virology is not my expertise. I appreciate any clarifications from you. > Thanks. > > Jiahong Shao > Dept. of Botany > Univ. of Florida > PFU: if you titer a phage lysate for plaques, this is the number of plaques you get per unit volume (plaque forming units). In simple terms, this is the phage titer you observe when working with a functional phage. TU: If you have packaged phagemids, these don't form plaques because they are esentially plasmids. However you can use them to get Amp-R colonies (or whatever antibiotic) after infection of suitable recipient bacterial strain. TU is the same as PFU above except you are looking for transduction to Amp-R colonies instead of plaques. These both are measures of viable packaged particles in a lysate. The number of actual virions may be very different. These can only be measured by some physical technique such as electron microscopy or indirectly by an Elisa assay or something similar. But often many virions are not functional and will not give actual plaques, hence the PFU value is not always the same as the number of actual virions. But no body generally measures the number of virions. Hope this helps. Michael Benedik Department of Biochemical Sciences University of Houston benedik@uh.edu From owner-repertoires@net.bio.net Mon Sep 30 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Alexy Eroshkin Newsgroups: bionet.molecules.repertoires Subject: ANNOUNCE ProAnWin: protein alignment & structure-activity analysis Date: 1 Oct 1996 11:19:40 +0100 Organization: State Research Center of Virology & Biotechnology VECTOR Lines: 262 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <52qr7s$m2k@mserv1.dl.ac.uk> Original-To: molreps@dl.ac.uk To: molreps@dl.ac.uk From: Alexey Eroshkin Subject: ANNOUNCE ProAnWin: protein alignment and structure-activity analysis ************************************** ProAnWin - Protein Analyst for Windows ************************************** State Research Center of Virology and Biotechnology Koltsovo, Novosibirsk Region, 633159 Russia and Irina Pika, Anatoly Frolov, Vladimir Ivanisenko with Alexey Eroshkin are pleased to announce the availability of new MS Windows application for multiple protein sequence alignment, comparative sequences analysis, studying protein structure-activity (property/genotype) relationships and designing site-directed mutagenesis. DESCRIPTION: ProAnWin studies the relationships between protein/peptide activity (or property or related phenotype) and characteristics of some regions in primary or tertiary structure of these molecules. Structure-activity analysis is based on the sequences of protein family, data on protein activity (pK, ED50, Km or any other) and, if available, 3D structure of one of these proteins (supposing the common 3D fold for all the homologs). The main aim is to find out the factors responsible for the variation of protein activities: location of activity-modulating site and important structural characteristics of the site. The program makes the following: input of sequences from several formats (SWISS-PROT, PIR, FASTA, GCG, CLUSTAL) and 3D structure in PDB format; flexible multiple protein sequences alignment and threading sequences into known 3D structure (ClustalV + manual alignment); input of user-defined protein activities, properties or related phenotypes (with possibility to transform activity: log(x), 1/x, etc.); calculation of many characteristics (hydrophobicity, amphipathicity, etc.) of linear and spatial protein sites; fast multiple (up to eight independent factors) linear regression analysis of structure-activity relationships; activity prediction for untested or mutated proteins; data visualization (regression plots, 3D pictures with sites highlighted, multiple alignments); displaying found sites on sequences and 3D structure. The program has two main related windows - with protein sequences and with 3D structure; any site highlighted in sequences is highlighted in 3D structure and vise versa. ProAnWin aligns complete set of sequences, subset or any selected block, providing thus possibility for iterative alignment that preserve some previously found blocks or those imposed from some biological data (active center, catalytic residues). The program can be applied to analysis of various protein-related biological data, to prediction of activity (phenotype) of newly sequenced proteins and to simulation of protein-engineering experiments. DATA EXAMPLES: 1. The family of disintegrins (proteins from snake venom) with tested activity. Name Sequence (part) Activity* 41 51 61 71 81 Trigramin alpha QCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNP 130 Albolabrin .............MKK..I..R............I........ 222 Elegantin ..AD.......R.KKKR.I..R....NP..R.T.Q..D....G 136 Flavoridin ..AD.......R.KKKTGI.......FP..R.T.L.ND...WN 100 Batroxastatin ..A........R.KGA.KI..R....NP..R.T.Q..D....R 133 Applagin ..A........L.MK.....-R.....VN.....I........ 50 Kistrin ........E..K.SRA.KI...P...MP..R.T.Q..D...YH 128 Echistatin alpha E.ES.P..RN.L.LK...I.LR.....M......LTCP..... 56 Bitistatin ..NH.E.....K.KKAR.........WN....T.K.SD..W.H 237 Bitan alpha ..NH.E.....R.KKA..........WN....T.K.SD..W.H 108 * - Activity is measured as the concentration of protein (in nM) required to 50% attenuation of platelet-rich plasma aggregation stimulated by adenosine-diphosphate. 2. The set of synthetic peptides with tested antimicrobial activity Name Activity* Peptide sequence Analog A2 400 GIHYLSHKSFSKFFAGVGKFTNS Analog A1 100 GIHYLSHKSFSKFFAGVQKFTNS Antisense P 60 GIHYLSHKSFSKFFCGVQKFTNS Analog B1 40 GIHYLSHKSFSKFFKGVQKFTNS Analog B2 40 GIHYLSHKSFSKFFKGVGKFTNS Magainin 2 20 GIGKFLHSAKKFGKAFVGEIMNS Analog C1 20 GIHKLSHKSFSKFFKGVQKFTNS Analog C2 20 GIHKLSHKSFSKFFKGVGKFTNS Analog P1 10 AIHNFAHKSFAKFFRAVKKFANA Analog P2 5 AIHNLAHKSLAKLLRAVKKLANA Analog P3 5 GIHNFAHKSFAKFFRAVKKFANS Analog M2 3 KIHKLAHKLLKKLLKAVKKLAKA * - Minimal inhibitory concentration (in mcg/ml) against E.coli 3. The set of unrelated peptides with tested immunogenicity. ------------------------------------------------- Protein Oncogene Sequence Immuno- region genicity* ------------------------------------------------- 409-425 C-SRC RLIEDNEYTARQGAKFP 4 468-482 C-SRC NREVLDQVERGYRMP 4 499-508 C-SRC WRRDPEERPT 4 001-018 V-KI-RAS MTEYKLVVVGASGVGKSA 5 119-135 V-KI-RAS DLPSRTVDTKQAQELAR 5 161-175 V-KI-RAS REIRQYRLKKISKEE 2 001-018 V-HA-RAS MTEYKLVVVGARGVGKSA 4 001-018 C-HA(EJ)-RAS MTEYKLVVVGAVGVGKSA 3 001-018 C-HA-RAS MTEYKLVVVGAGGVGKSA 5 029-044 V-HA-RAS VDEYDPTIEDSYRKQV 4 091-108 V-HA-RAS EDIHQYREQIKRVKDSDD 4 126-136 V-HA-RAS ESRQAQALARS 4 146-155 V-HA-RAS AKTRQGVEDA 5 160-179 V-HA-RAS VREIRQHKLRKLNPPDESGP 5 011-024 V-MYB PQESSKAGPPSGTT 4 033-047 V-MYB MAFAHNPPAGPLPGA 3 146-162 V-MYB DNTRTSGDNAPVSCLGE 4 168-186 V-MYB PSPPVDHGCLPEESASPAR 4 170-185 V-MYB PPVDHGCLPEESASPA 2 247-260 V-MYB PFHKDQTFTEYRKM 4 247-265 V-MYB PFHKDQTFTEYRKMHGGAV 4 541-555 V-FES RHSTSSSEQEREGGR 4 584-593 V-FES PEVQKPLHEQ 4 782-796 V-FES FLRTEGARLRMKTLL 4 840-846 V-FES SREAADG 0 893-905 V-FES ASPYPNLSNQQTR 3 901-913 V-FES NQQTREFVEKGGR 4 222-234 V-MYC PPTTSSDSEEEQE 0 323-334 V-MYC RTLDSEENDKRR 4 340-350 V-MYC ERQRRNELKLR 4 363-371 V-MYC NNEKAPKVV 1 389-403 V-MYC RLIAEKEQLRRRREQ 4 395-405 V-MYC EQLRRRREQLK 4 400-406 V-MYC RREQLKH 0 * logarithm of antipeptide antibody titers. 4. Phenotype-genotype correlations. Influenza A virus M2 protein from strains sensitive (labeled "sen") and resistant to amantadine or rimantadine ("res"). Strain Sensitivity Sequence (N-terminal part only) PR8-34 res MSLLTEVETPIRNEWGCRCNGSSDPLAIAANIIGILHLILWILDR MON88 res ....................D.................T...... LEN3-83 res ..........................T...........T...... MOS88 res ..........................T...........T...... MON86 res ..........................T...........T...... SVER82 res ..........................T...........T...... WS33 res ....................D.....V.................. LEN85 res ....................D.....VV................. WSN33 res ....................D....FV.................. LEN49 res ....................D.....VV..........T...... LEN6-83 res ....................D...S.VV..S.............. SWONT81 res ....................D.....VA..S.............. SW29-37 res ....................D.....VA..S.............. SWIA30 res ..........T.........D.....VA..S.............. SWWIS61 res ..........T.S.......D.....VA..S.............. SWIA88 res .................K..D.....VAV.S.............. AA60 sen ....................D.....VV..S.............H KOREA68 sen ....................D.....VV..S......F....... BANG79 sen ....................D.....VV..S.............. FW50 se