From owner-population-bio@net.bio.net Wed Oct 02 23:00:00 1996 Path: biosci!daresbury!not-for-mail From: Alexy Eroshkin Newsgroups: bionet.population-bio Subject: ANNOUNCE ProAnWin: protein alignment and structure-activity analysis Date: 3 Oct 1996 12:13:41 +0100 Organization: State Research Center of Virology & Biotechnology VECTOR Lines: 263 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <530755$qgu@mserv1.dl.ac.uk> Original-To: pop-bio@dl.ac.uk To: pop-bio@dl.ac.uk From: Alexey Eroshkin Subject: ANNOUNCE ProAnWin: protein alignment and structure-activity analysis ************************************** ProAnWin - Protein Analyst for Windows ************************************** State Research Center of Virology and Biotechnology Koltsovo, Novosibirsk Region, 633159 Russia and Irina Pika, Anatoly Frolov, Vladimir Ivanisenko with Alexey Eroshkin are pleased to announce the availability of new MS Windows application for multiple protein sequence alignment, comparative sequences analysis, studying protein structure-activity (property/phenotype) relationships and designing site-directed mutagenesis. DESCRIPTION: ProAnWin studies the relationships between protein/peptide activity (or property or related phenotype) and characteristics of some regions in primary or tertiary structure of these molecules. Structure-activity analysis is based on the sequences of protein family, data on protein activity (pK, ED50, Km or any other) and, if available, 3D structure of one of these proteins (supposing the common 3D fold for all the homologs). The main aim is to find out the factors responsible for the variation of protein activities: location of activity-modulating site and important structural characteristics of the site. The program makes the following: input of sequences from several formats (SWISS-PROT, PIR, FASTA, GCG, CLUSTAL) and 3D structure in PDB format; flexible multiple protein sequences alignment and threading sequences into known 3D structure (ClustalV + manual alignment); input of user-defined protein activities, properties or related phenotypes (with possibility to transform activity: log(x), 1/x, etc.); calculation of many characteristics (hydrophobicity, amphipathicity, etc.) of linear and spatial protein sites; fast multiple (up to eight independent factors) linear regression analysis of structure-activity relationships; activity prediction for untested or mutated proteins; data visualization (regression plots, 3D pictures with sites highlighted, multiple alignments); displaying found sites on sequences and 3D structure. The program has two main related windows - with protein sequences and with 3D structure; any site highlighted in sequences is highlighted in 3D structure and vise versa. ProAnWin aligns complete set of sequences, subset or any selected block, providing thus possibility for iterative alignment that preserve some previously found blocks or those imposed from some biological data (active center, catalytic residues). The program can be applied to analysis of various protein-related biological data, to prediction of activity (phenotype) of newly sequenced proteins and to simulation of protein-engineering experiments. DATA EXAMPLES: 1. The family of disintegrins (proteins from snake venom) with tested activity. Name Sequence (part) Activity* 41 51 61 71 81 Trigramin alpha QCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNP 130 Albolabrin .............MKK..I..R............I........ 222 Elegantin ..AD.......R.KKKR.I..R....NP..R.T.Q..D....G 136 Flavoridin ..AD.......R.KKKTGI.......FP..R.T.L.ND...WN 100 Batroxastatin ..A........R.KGA.KI..R....NP..R.T.Q..D....R 133 Applagin ..A........L.MK.....-R.....VN.....I........ 50 Kistrin ........E..K.SRA.KI...P...MP..R.T.Q..D...YH 128 Echistatin alpha E.ES.P..RN.L.LK...I.LR.....M......LTCP..... 56 Bitistatin ..NH.E.....K.KKAR.........WN....T.K.SD..W.H 237 Bitan alpha ..NH.E.....R.KKA..........WN....T.K.SD..W.H 108 * - Activity is measured as the concentration of protein (in nM) required to 50% attenuation of platelet-rich plasma aggregation stimulated by adenosine-diphosphate. 2. The set of synthetic peptides with tested antimicrobial activity Name Activity* Peptide sequence Analog A2 400 GIHYLSHKSFSKFFAGVGKFTNS Analog A1 100 GIHYLSHKSFSKFFAGVQKFTNS Antisense P 60 GIHYLSHKSFSKFFCGVQKFTNS Analog B1 40 GIHYLSHKSFSKFFKGVQKFTNS Analog B2 40 GIHYLSHKSFSKFFKGVGKFTNS Magainin 2 20 GIGKFLHSAKKFGKAFVGEIMNS Analog C1 20 GIHKLSHKSFSKFFKGVQKFTNS Analog C2 20 GIHKLSHKSFSKFFKGVGKFTNS Analog P1 10 AIHNFAHKSFAKFFRAVKKFANA Analog P2 5 AIHNLAHKSLAKLLRAVKKLANA Analog P3 5 GIHNFAHKSFAKFFRAVKKFANS Analog M2 3 KIHKLAHKLLKKLLKAVKKLAKA * - Minimal inhibitory concentration (in mcg/ml) against E.coli 3. The set of unrelated peptides with tested immunogenicity. ------------------------------------------------- Protein Oncogene Sequence Immuno- region genicity* ------------------------------------------------- 409-425 C-SRC RLIEDNEYTARQGAKFP 4 468-482 C-SRC NREVLDQVERGYRMP 4 499-508 C-SRC WRRDPEERPT 4 001-018 V-KI-RAS MTEYKLVVVGASGVGKSA 5 119-135 V-KI-RAS DLPSRTVDTKQAQELAR 5 161-175 V-KI-RAS REIRQYRLKKISKEE 2 001-018 V-HA-RAS MTEYKLVVVGARGVGKSA 4 001-018 C-HA(EJ)-RAS MTEYKLVVVGAVGVGKSA 3 001-018 C-HA-RAS MTEYKLVVVGAGGVGKSA 5 029-044 V-HA-RAS VDEYDPTIEDSYRKQV 4 091-108 V-HA-RAS EDIHQYREQIKRVKDSDD 4 126-136 V-HA-RAS ESRQAQALARS 4 146-155 V-HA-RAS AKTRQGVEDA 5 160-179 V-HA-RAS VREIRQHKLRKLNPPDESGP 5 011-024 V-MYB PQESSKAGPPSGTT 4 033-047 V-MYB MAFAHNPPAGPLPGA 3 146-162 V-MYB DNTRTSGDNAPVSCLGE 4 168-186 V-MYB PSPPVDHGCLPEESASPAR 4 170-185 V-MYB PPVDHGCLPEESASPA 2 247-260 V-MYB PFHKDQTFTEYRKM 4 247-265 V-MYB PFHKDQTFTEYRKMHGGAV 4 541-555 V-FES RHSTSSSEQEREGGR 4 584-593 V-FES PEVQKPLHEQ 4 782-796 V-FES FLRTEGARLRMKTLL 4 840-846 V-FES SREAADG 0 893-905 V-FES ASPYPNLSNQQTR 3 901-913 V-FES NQQTREFVEKGGR 4 222-234 V-MYC PPTTSSDSEEEQE 0 323-334 V-MYC RTLDSEENDKRR 4 340-350 V-MYC ERQRRNELKLR 4 363-371 V-MYC NNEKAPKVV 1 389-403 V-MYC RLIAEKEQLRRRREQ 4 395-405 V-MYC EQLRRRREQLK 4 400-406 V-MYC RREQLKH 0 * logarithm of antipeptide antibody titers. 4. Phenotype-genotype correlations. Influenza A virus M2 protein from strains sensitive (labeled "sen") and resistant to amantadine or rimantadine ("res"). Strain Sensitivity Sequence (N-terminal part only) PR8-34 res MSLLTEVETPIRNEWGCRCNGSSDPLAIAANIIGILHLILWILDR MON88 res ....................D.................T...... LEN3-83 res ..........................T...........T...... MOS88 res ..........................T...........T...... MON86 res ..........................T...........T...... SVER82 res ..........................T...........T...... WS33 res ....................D.....V.................. LEN85 res ....................D.....VV................. WSN33 res ....................D....FV.................. LEN49 res ....................D.....VV..........T...... LEN6-83 res ....................D...S.VV..S.............. SWONT81 res ....................D.....VA..S.............. SW29-37 res ....................D.....VA..S.............. SWIA30 res ..........T.........D.....VA..S.............. SWWIS61 res ..........T.S.......D.....VA..S.............. SWIA88 res .................K..D.....VAV.S.............. AA60 sen ....................D.....VV..S.............H KOREA68 sen ....................D.....VV..S......F....... BANG79 sen ....................D.....VV..S.............. FW50 sen ....................D.....VV..S.............. MEM88 sen ....................D.....VV..S.............. USSR77 sen .............Q......D.....VV..S.............. PINALB79 sen ..........T..G.E.K.SD.....V...S.............. SWHK82 sen ..........T..G.E.K.SD.....V...S.............. SWNED85 sen ..........T..G....FSD.....V...S.............. FPVR34 sen ..........T..G.E....D.....I...S............N. MLRDNY78 sen ..........T..G.E.K.SD.....V...S.............. TYMN81 sen ..........T..G.E.K.SD.....V...S.............. TYMN80 sen ..........T..G.E.K.SD.....V...S.............. CKVIC85 sen ..........T..G.E.K.SD.....V...S.............. ProAnWin IS USEFUL IN: - protein structure-function and structure-activity investigations; - designing proteins and peptides with improved activity; - making multiple protein alignments and getting sense from it; - studying phenotype-genotype correlations; - preparation of protein 3D pictures with sites highlighted; - comparative protein sequence analysis. AVAILABILITY: ProAnWin is available (as self-extracted archive) from EBI software library: ftp://ftp.ebi.ac.uk/pub/software/dos/proanwin and, in Eastern Hemisphere, from NSC software library: ftp://ftp.bionet.nsc.ru/pub/biology/vector/proanwin.dem/paw$.exe The version is limited in number of analyzed sequences. INSTALLATION: The files required to run ProAnWin are distributed in the form of a single compressed file. Create a directory "PROANWIN" in your hard disk, for example, C. Copy the file to the directory, run the file from DOS prompt and answer Yes to all questions. To start the program run PROAWIN.EXE from windows. PROGRAM CONTENT: Directory: Main directory - program modules DATA - examples of data and output files; amino acid physico-chemical properties (>50); manual ALIGNS - 50 aligned protein family sequences PUBLICATIONS: 1. Eroshkin A.M., Zhilkin P.A., Fomin V.I. Algorithm and computer program PROANAL for analysis of relationship between structure and activity in a family of proteins or peptides. CABIOS, 1993, 9, 491-497. 2. Eroshkin A.M., Minenkova O.O., Fomin V.A., Ivanisenko V.A., Ilyichev A.A. Analysis of peptide fragment insertions into major coat protein of bacteriophages M13, f1 and fd. Relation of protein structural characteristics and viability of mutant phages. Molec. Biology (Russia), 1993, 27, 1345-1355. 3. Eroshkin A.M., Fomin V.I., Zhilkin P.A., Ivanisenko V.A., Kondrakhin Y.V. PROANAL version 2: multifunctional program for analysis of multiple protein sequence alignments and studying structure-activity relationships in protein families. CABIOS, 1995, 11, 39-44. 4. Morozov B.M., Ivanisenko V.A., Eroshkin A.M., Ugarova N.N. Analysis of relations between bioluminescence color and the structure of beetle luciferases: identification of the sites influencing bioluminescence color. Molec. Biology (Russia), in press. Comments, bug reports, suggestions for new features are welcome and should be sent by e-mail to: Alexey Eroshkin OTHER TOOLS AVAILABLE: ProAnalyst, Multifunctional analysis of protein sequences and structures (MS-DOS version of ProAnWin with additional functionality: searching motifs, physico-chemical plots, alphabetical and physico-chemical analysis of protein sequence variation, structure-activity determination profile, etc.): IUBio archive: ftp://iubio.bio.indiana.edu/molbio/ibmpc/panalys1 EMBL library: ftp://ftp.ebi.ac.uk/pub/software/dos/proanalyst NSC library: ftp://ftp.bionet.nsc.ru/pub/biology/vector/proanaly.dem/panalys$ ProMSED, Protein Multiple Sequences EDitor for MS Windows 3.x/95 ("a la" Word for Windows style + ClustalV + manual alignment + amino acid coloring + more): EMBL library: ftp://ftp.ebi.ac.uk/pub/software/dos/promsed NSC library: ftp://ftp.bionet.nsc.ru/pub/biology/vector/promsed.dem/promsed$ IUBio archive: ftp://iubio.bio.indiana.edu/molbio/ibmpc/promsed1 ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ Dr. Alexey Eroshkin Institute of Molecular Biology E.mail: eroshkin@vector.nsk.su State Research Center of Virology and Tel: +7 (3832) - 647774 Biotechnology "Vector" Fax: +7 (3832) - 328831 Koltsovo, Novosibirsk Region 633159 Russia ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ From owner-population-bio@net.bio.net Thu Oct 03 23:00:00 1996 Path: biosci!IRRI.CGNET.COM!JPHAM From: JPHAM@IRRI.CGNET.COM Newsgroups: bionet.population-bio Subject: Social Sci./Genetic Resources: Position offered at IRRI Date: 3 Oct 1996 23:22:21 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 92 Sender: daemon@net.bio.net Distribution: world Message-ID: <01IA8XSAGHNM8WZFJZ@IRRI.CGNET.COM> NNTP-Posting-Host: net.bio.net Dear colleagues, I am a geneticist, working with the project on "Dynamic conservation = of rice=20 genetic resources" at the International Rice Research Institute. I shall be grateful if you would circulate the announcement below to persons you feel might have an interest, or know others who might. Thanks very much for your help, Jean-Louis Pham Genetic Resources Center Fax: (63-2) 891-1292 International Rice Research Institute (63-2) 817-8470 P.O. Box 933 (63-2) 761-2406 1099 Manila =20 The Philippines E-mail: J.PHAM@CGNET.COM ------------------------------------------------------------------- ************************************************************* IRRI International Rice Research Institute Position announcement for Affiliate Scientist The Philippine-based International Rice Research=20 Institute (IRRI) is seeking an affiliate scientist for its Genetic Resources Center. IRRI, supported by the=20 Consultative Group on International Agricultural=20 Research, is a nonprofit, autonomous organization=20 engaged in research and training on rice-related=20 technology. The research agenda for the Institute=92s=20 Genetic Resources Center is carried out in collaboration=20 with other scientific divisions of IRRI and researchers in=20 rice growing countries. Applicants for this position should have a social scientist=20 background in such disciplines as anthropology or=20 sociology. The appointee will continue work on the=20 socioeconomic basis of on-farm conservation of rice=20 germplasm and will analyze village and household-level=20 data related to the management of rice varieties by=20 small-scale farmers in several Asian countries. While=20 much of the data has already been collected, the affiliate=20 scientist may have to conduct a small amount of=20 fieldwork and coordinate some data collection. Candidates should have a Ph D degree in a relevant=20 discipline, with a particularly good understanding of=20 farmers' decision-making processes. They should also=20 have 1) a background in agriculture, 2) fieldwork=20 experience working with small-scale farmers in=20 developing countries (e.g., farmer interviews and=20 surveys, gender analysis), and 3) an ability to work in a=20 multidisciplinary setting. The affiliate scientist will=20 collaborate with a plant population geneticist, plant=20 breeders, and other social scientists of national programs=20 in Asia. Strong analytical skills are required, as well as=20 familiarity with multivariate analyses, multiple=20 regression, and nonparametric statistics. Recent=20 graduates are encouraged to apply. The position is located at IRRI's headquarters south of Manila and involves moderate international travel.=20 Salary and perquisites for the position are internationally=20 competitive. The Institute welcomes women applicants.=20 Suitable candidates will be interviewed during the=20 second half of November. The duration of the=20 appointment will be 2 years from 1 January 1997. Send a comprehensive curriculum vitae and names,=20 addresses, and fax numbers of three referees, by 31 October 1996 to: =09Dr. M.T. Jackson =09Head, Genetic Resources Center =09International Rice Research Institute =09P.O. Box 933, Manila 1099, Philippines =09Tel: (63-2) 818 1926; Fax: (63-2) 891-1292 =09Email: m.jackson@cgnet.com ************************************************************* From owner-population-bio@net.bio.net Thu Oct 03 23:00:00 1996 Path: biosci!CNS.BU.EDU!cas-cns From: cas-cns@CNS.BU.EDU (CAs/CNS) Newsgroups: bionet.population-bio Subject: International Conference on VISION, RECOGNITION, ACTION Date: 4 Oct 1996 11:51:02 -0700 Organization: Boston University - Cognitive and Neural Systems Lines: 381 Sender: daemon@net.bio.net Distribution: world Message-ID: <199610041824.OAA15927@cns.bu.edu> Reply-To: cas-cns@cns.bu.edu NNTP-Posting-Host: net.bio.net ***** CALL FOR PAPERS ***** International Conference on VISION, RECOGNITION, ACTION: NEURAL MODELS OF MIND AND MACHINE May 28-31, 1997 Sponsored by the Center for Adaptive Systems and the Department of Cognitive and Neural Systems Boston University with financial support from the Defense Advanced Research Projects Agency and the Office of Naval Research This conference will include a day of tutorials (May 28) followed by 3 days of 21 invited lectures and contributed lectures and posters by experts on the biology and technology of how the brain and other intelligent systems see, understand, and act upon a changing world. Meeting updates can be found at http://cns-web.bu.edu/cns-meeting/. Hotel and restaurant information can also be found here. CONFIRMED INVITED SPEAKERS AND PROGRAM OUTLINE WEDNESDAY, MAY 28, 1997 TUTORIALS STEPHEN GROSSBERG "Vision, Brain, and Technology" (3 hours in two 1-1/2 hour lectures) This tutorial will provide a self-contained introduction to recent models of how the brain sees. It will also illustrate how these models have been used to help solve difficult image processing problems in technology. The biological part will discuss neural models of visual form, color, depth, figure-ground separation, motion, and attention, and how these several processes cooperate to generate complex percepts. The tutorial will build a theoretical bridge between data about visual perception and data about the architecture and dynamics of the visual brain. Technological applications to image restoration, texture labeling, figure-ground separation, and related problems will be described. GAIL CARPENTER "Self-Organizing Neural Networks for Learning, Recognition, and Prediction: ART Architectures and Applications" (2 hours) In 1976, Stephen Grossberg introduced adaptive resonance as a theory of human cognitive information processing. Over the past decade, the theory has led to an evolving series of real-time neural networks (ART models) that self-organize recognition categories in response to arbitrary sequences of input patterns. The intrinsic stability of an ART system allows rapid learning of new information while essential components of previously learned patterns are preserved. This tutorial will describe basic ART design principles, analytic tools, and benchmark simulations. Both unsupervised networks such as ART 1, ART 2, ART 3, and fuzzy ART, and supervised learning architectures such as ARTMAP, fuzzy ARTMAP, and ART-EMAP will be discussed. Successful applications of the ART and ARTMAP networks, including the Boeing parts retrieval CAD system, automatic mapping from remote sensing satellite measurements, and medical database prediction will be outlined. Computational elements of the recently developed dART and dARTMAP networks, that feature distributed code representations, will also be introduced. ERIC SCHWARTZ "Algorithms and Hardware for the Application of Space-Variant Active Vision to High Performance Machine Vision" (2 hours) The term space-variance refers to the fact that all higher vertebrate visual systems are based on spatial architectures which have non-constant resolution across the visual field. It has been shown that such architectures can lead to up to four orders of magnitude of compression in the space-complexity of vision tasks. However, there are fundamental algorithmic and hardware problems involved in the exploitation of these observations in computer vision, many of which have benefited from considerable progress during the past several years. In this tutorial, a brief outline of the anatomical basis for the notion of space-variance will be provided. Several examples of space-variant active vision systems will be then be discussed, focusing on the hardware specifications for sensors, optics, actuators and DSP based parallel processors. Finally, a review of the algorithmic aspects of these systems will be presented, including issues related to early vision (i.e., edge enhancement via nonlinear diffusion methods), and to pattern matching, based on recent development of an exponential chirp algorithm which can perform high-speed quasi-shift invariant processing on logarithmic image architectures. Functioning examples of space-variant active vision systems based on these developments will be demonstrated, included a miniature visually guided autonomous vehicle, a machine vision system for reading license plates of high-speed vehicles for traffic control, and a blind-prosthetic device based on a "wearable" active vision system. ******************** TUTORIAL BIOSKETCHES: GAIL CARPENTER is professor in the departments of Cognitive and Neural Systems (CNS) and Mathematics at Boston University. She is the CNS Director of Graduate Studies; 1989 Vice-President and 1994-96 Secretary of the International Neural Network Society (INNS); organization chair of the 1988 INNS annual meeting; and a member of the editorial boards of Brain Research, IEEE Transactions on Neural Networks, Neural Computation, and Neural Networks. She has served on the INNS Board of Governors since its founding in 1987, and is a member of the Council of the American Mathematical Society. She is a leading architect of the Adaptive Resonance Theory (ART) family of architectures for fast learning, pattern recognition, and prediction of nonstationary databases, including both unsupervised (ART 1, ART 2, ART 2-A, ART 3, fuzzy ART, distributed ART) and supervised (ARTMAP, fuzzy ARTMAP, ART-EMAP, distributed ARTMAP) ART networks. These systems have been used for a wide range of applications, such as medical diagnosis, remote sensing, automatic target recognition, mobile robots, and database management. Her earlier research includes the development, computational analysis, and applications of neural models of nerve impulse generation (Hodgkin-Huxley equations), vision, cardiac rhythms, and circadian rhythms. Professor Carpenter received her graduate training in mathematics at the University of Wisconsin and was a faculty member at MIT and Northeastern University before moving to Boston University. STEPHEN GROSSBERG is Wang Professor of Cognitive and Neural Systems and Professor of Mathematics, Psychology, and Biomedical Engineering at Boston University. He is the founder and Director of the Center for Adaptive Systems, as well as the founder and Chairman the Department of Cognitive and Neural Systems. He founded and was first President of the International Neural Network Society and also founded and is co-editor-in-chief of the Society's journal, Neural Networks. Grossberg was General Chairman of the first IEEE International Conference on Neural Networks. He is on the editorial boards of Brain Research, Journal of Cognitive Neuroscience, Behavioral and Brain Sciences, Neural Computation, IEEE Transactions on Neural Networks, and Adaptive Behavior. He organized two multi-institutional Congressional Centers of Excellence for research on biological neural networks and their technological applications. He received the IEEE Neural Network Pioneer award, the INNS Leadership Award, the Thinking Technology Award of the Boston Computer Society, and is a Fellow of the American Psychological Association and the Society of Experimental Psychologists. Grossberg and his colleagues have pioneered and developed a number of the fundamental principles, mechanisms, and architectures that form the foundation for contemporary neural network research. This work focuses upon the design principles and mechanisms which enable the behavior of individuals to adapt successfully in real-time to unexpected environmental changes. Core models pioneered by this approach include competitive learning and self-organizing feature maps, adaptive resonance theory, masking fields, gated dipole opponent processes, associative outstars and instars, associative avalanches, nonlinear cooperative-competitive feedback networks, boundary contour and feature contour systems, and vector associative maps. Grossberg received his graduate training at Stanford University and Rockefeller University, and was a Professor at MIT before assuming his present position at Boston University. ERIC SCHWARTZ received the PhD degree in High Energy Physics from Columbia University in 1973, followed by post-doctoral studies with E. Roy John at New York Medical College in neurophysiology. He has served as Associate Professor of Psychiatry at New York University Medical Center and Associate Professor of Computer Science at the Courant Institute of Mathematical Sciences. In 1985, he organized the first Symposium on Computational Neuroscience, and in 1989 founded Vision Applications, Inc. which designs and builds prototype machine vision systems based on space-variant active vision systems. Currently, he is Professor of Cognitive and Neural Systems, Electrical Engineering and Computer Systems and Anatomy and Neurobiology at Boston University. His research experience includes experimental particle physics, physiology (single cell recording), anatomy (2DG, PETT, MRI), computer graphics and image processing, VLSI design, actuator design, and neural modeling. ************************* THURSDAY, MAY 29, 1997 INVITED LECTURES Robert Shapley, New York University: Brain Mechanisms for Visual Perception of Occlusion George Sperling, University of California, Irvine: An Integrated Theory for Attentional Processes in Vision, Recognition, and Memory Patrick Cavanagh, Harvard University: Direct Recognition Stephen Grossberg, Boston University: Perceptual Grouping and Attention during Cortical Form and Motion Processing Robert Desimone, National Institute of Mental Health: Neuronal Mechanisms of Visual Attention Ennio Mingolla, Boston University: Visual Search Patricia Goldman-Rakic, Yale University Medical School: The Machinery of Mind: Models from Neurobiology Larry Squire, San Diego VA Medical Center: Brain Systems for Recognition Memory There will also be a contributed poster session on this day. FRIDAY, MAY 30, 1997 INVITED LECTURES Eric Schwartz, Boston University: Multi-Scale Vortex Structure of the Brain: Anatomy as Architecture in Biological and Machine Vision Lance Optican, National Eye Institute: Neural Control of Rapid Eye Movements John Kalaska, University of Montreal: Reaching to Visual Targets: Cerebral Cortical Neuronal Mechanisms Rodney Brooks, Massachusetts Institute of Technology: Models of Vision-Based Human Interaction There will also be a contributed talk session and a reception, followed by the KEYNOTE LECTURE Stuart Anstis, University of California, San Diego: Moving in Unexpected Directions SATURDAY, MAY 31, 1997 INVITED LECTURES Azriel Rosenfeld, University of Maryland: Some Viewpoints on Vision Terrance Boult, Lehigh University: Polarization Vision Allen Waxman, MIT Lincoln Laboratory: Opponent Color Models of Visible/IR Fusion for Color Night Vision Gail Carpenter, Boston University: Distributed Learning, Recognition, and Prediction in ART and ARTMAP Networks Tomaso Poggio, Massachusetts Institute of Technology: Representing Images for Visual Learning Michael Jordan, Massachusetts Institute of Technology: Graphical Models, Neural Networks, and Variational Approximations Andreas Andreou, Johns Hopkins University: Mixed Analog/Digital Neuromorphic VLSI for Sensory Systems Takeo Kanade, Carnegie Mellon University: Computational VLSI Sensors: Integrating Sensing and Processing There will also be a contributed poster session on this day. CALL FOR ABSTRACTS: Contributed abstracts by active modelers of vision, recognition, or action in cognitive science, computational neuroscience, artificial neural networks, artificial intelligence, and neuromorphic engineering are welcome. They must be received, in English, by January 31, 1997. Notification of acceptance will be given by February 28, 1997. A meeting registration fee must accompany each Abstract. See Registration Information below for details. The fee will be returned if the Abstract is not accepted for presentation and publication in the meeting proceedings. Each Abstract should fit on one 8 x 11" white page with 1" margins on all sides, single-column format, single-spaced, Times Roman or similar font of 10 points or larger, printed on one side of the page only. Fax submissions will not be accepted. Abstract title, author name(s), affiliation(s), mailing, and email address(es) should begin each Abstract. An accompanying cover letter should include: Full title of Abstract, corresponding author and presenting author name, address, telephone, fax, and email address. Preference for oral or poster presentation should be noted. (Talks will be 15 minutes long. Posters will be up for a full day. Overhead, slide, and VCR facilities will be available for talks.) Abstracts which do not meet these requirements or which are submitted with insufficient funds will be returned. The original and 3 copies of each Abstract should be sent to: CNS Meeting, c/o Cynthia Bradford, Boston University, Department of Cognitive and Neural Systems, 677 Beacon Street, Boston, MA 02215. The program committee will determine whether papers will be accepted in an oral or poster presentation, or rejected. REGISTRATION INFORMATION: Since seating at the meeting is limited, early registration is recommended. To register, please fill out the registration form below. Student registrations must be accompanied by a letter of verification from a department chairperson or faculty/research advisor. If accompanied by an Abstract or if paying by check, mail to: CNS Meeting, c/o Cynthia Bradford, Boston University, Department of Cognitive and Neural Systems, 677 Beacon Street, Boston, MA 02215. If paying by credit card, mail to the above address, or fax to (617) 353-7755. STUDENT FELLOWSHIPS: A limited number of fellowships for PhD candidates and postdoctoral fellows are available to at least partially defray meeting travel and living costs. The deadline for applying for fellowship support is January 31, 1997. Applicants will be notifed by February 28, 1997. Each application should include the applicant's CV, including name; mailing address; email address; current student status; faculty or PhD research advisor's name, address, and email address; relevant courses and other educational data; and a list of research articles. A letter from the listed faculty or PhD advisor on offiicial institutional stationery should accompany the application and summarize how the candidate may benefit from the meeting. Students who also submit an Abstract need to include the registration fee with their Abstract. Reimbursement checks will be distributed after the meeting. Their size will be determined by student need and the availability of funds. -------------------------------------------------- REGISTRATION FORM (Please Type or Print) Vision, Recognition, Action: Neural Models of Mind and Machine Boston University Boston, Massachusetts Tutorials: May 28, 1997 Meeting: May 29-31, 1997 Mr/Ms/Dr/Prof: Name: Affiliation: Address: City, State, Postal Code: Phone and Fax: Email: The conference registration fee includes the meeting program, reception, six coffee breaks, and the meeting proceedings. Two coffee breaks and a book of tutorial viewgraph copies will be covered by the tutorial registration fee. CHECK ONE: [ ] $55 Conference plus Tutorial (Regular) [ ] $40 Conference plus Tutorial (Student) [ ] $35 Conference Only (Regular) [ ] $25 Conference Only (Student) [ ] $30 Tutorial Only (Regular) [ ] $25 Tutorial Only (Student) Method of Payment: [ ] Enclosed is a check made payable to "Boston University". Checks must be made payable in US dollars and issued by a US correspondent bank. Each registrant is responsible for any and all bank charges. [ ] I wish to pay my fees by credit card (MasterCard, Visa, or Discover Card only). Type of card: Name as it appears on the card: Account number: Expiration date: Signature and date: -------------------------------------------------- From owner-population-bio@net.bio.net Thu Oct 03 23:00:00 1996 Path: biosci!daresbury!nntp-trd.UNINETT.no!sn.no!www.nntp.primenet.com!nntp.primenet.com!ddsw1!news.mcs.net!news.abs.net!cs.umd.edu!hecate.umd.edu!haven.umd.edu!purdue!mozo.cc.purdue.edu!macg417f.bio.purdue.edu!user From: myaber@bilbo.bio.purdue.edu (Carolina Yaber) Newsgroups: bionet.population-bio Subject: field assistant needed for the tropics Followup-To: bionet.population-bio Date: 3 Oct 1996 21:19:26 GMT Organization: Purdue University Lines: 8 Message-ID: NNTP-Posting-Host: macg417f.bio.purdue.edu Would you like to go to the Tropics? Do you have plans for next Spring 1997? If your answer is no, what do you think about going to the Tropics and being a field assistant for a couple of months? I work in the Venezuelan savanna with stripe-back wrens. I am a Ph.D student working on a population demographic study looking at dispersal patterns and viability of 5 populations. Please contact me (Carolina Yaber) at Purdue University at myaber@bilbo.bio.purdue.edu or at 317-494-4726 if you are interested. Thanks in advance. Carolina From owner-population-bio@net.bio.net Sun Oct 06 23:00:00 1996 Path: biosci!biosci!not-for-mail From: derepeny@ERE.UMontreal.CA (De Repentigny Yves) Newsgroups: bionet.general,bionet.population-bio Subject: Symposium de sciences biologiques/on biological sciences Date: 6 Oct 1996 22:12:50 -0700 Organization: Universite de Montreal Lines: 55 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Xref: biosci bionet.general:23508 bionet.population-bio:2063 SYMPOSIUM DE SCIENCES BIOLOGIQUES/SYMPOSIUM ON BIOLOGICAL SCIENCES UNIVERSITE DE MONTREAL Bonjour, Nous aimerions inviter toutes les personnes intéressées à venir assister au huitième Symposium de Sciences Biologiques de l'Université de Montréal, organisé par les étudiants-chercheurs du département de sciences biologiques de cette université. En cette occasion, les étudiants-chercheurs ainsi que les professeurs du département vous présenteront leurs sujets de recherche ainsi que les résultats de leurs investigations. Ce symposium aura lieu le 8 novembre 1996 à l'Institut de recherches en biologie végétale (IRBV), métro Pie-IX, près du Jardin Botanique, et le 9 novembre 1996 au pavillon Marie-Victorin de l'Université de Montréal, métro Edouard-Montpetit. Pour de plus amples renseignements sur l'horaire et les présentations, vous pouvez visiter notre site web à l'adresse suivante: http://alize.ere.umontreal.ca/~bleichec/symposium.html Merci! Hi, We would like to invite all the people interested in biology to the eighth Symposium on Biological Sciences of the Universite de Montreal, organized by the grad students of the department of biological sciences at that university. On this occasion, the grad students as well as the professors of the department will present you their research topics and the results of their investigations. This symposium will take place on November 8th, 1996 at the Institut de Recherches en Biologie Vegetale (IRBV), subway station Pie-IX, near the Botanical Garden, and on November 9th, 1996 at the Marie-Victorin Building of the Universite de Montreal, subway station Edouard-Montpetit. For more details on the schedule and the presentations, you can visit our web site at the following address: http://alize.ere.umontreal.ca/~bleichec/symposium.html Note: Most presentations will be delivered in French. Thanks! Yves de Repentigny Sciences biologiques Université de Montréal Pour le comité organisateur du symposium -- From owner-population-bio@net.bio.net Wed Oct 09 23:00:00 1996 Path: biosci!agate!spool.mu.edu!howland.erols.net!EU.net!uunet!in1.uu.net!news.ios.com!usenet From: Applied Biomathematics Newsgroups: bionet.population-bio Subject: job opportunities in quantitative ecology and ecotoxicology Date: 10 Oct 1996 12:39:54 GMT Organization: Internet Online Services Lines: 26 Message-ID: <53iqqq$ob8@news.ios.com> NNTP-Posting-Host: ppp-29.ts-1.suf.idt.net Mime-Version: 1.0 Content-Type: text/plain Content-Transfer-Encoding: quoted-printable X-Mailer: Mozilla 1.2 (Windows; U; 16bit) subject: job opportunities in quantitative ecology and ecotoxicology. Applied Biomathematics is a company carrying out research in ecology, conservation biology and risk analysis, and producing the RAMA= S library of ecological software. We have now filled the disease cluster analysis position we recently advertised, but we still exp= ect the following openings at the postdoctoral level: 1. From January 1997 for at least 1 year: data analysis and demographic modeling for endangered species: development of Windows sof= tware (roughly 75 % research, 25 % programming in Delphi). 2. From early 1997 for at least 1 year: development of Windows software for generating structured population models directly from c= hronic toxicity test results, and using these models for ecological risk assessment. Other tasks may include linking these models t= o metapopulation models, and carrying out ecological risk assessments for systems with several trophic levels affected by a toxicant= (roughly 50 % research, 50 % programming in Delphi). Interested candidates should visit the Applied Biomathematics homepage at http://gramercy.ios.com/~ramas to find out more about us, = then send a CV, reprints and any other relevant material by email, fax or mail to: Matthew Spencer Applied Biomathematics 100 North Country Road Setauket, NY 11777 USA. email ramas@gramercy.ios.com fax (516) 751-3435 phone (516) 751-4350 From owner-population-bio@net.bio.net Thu Oct 10 23:00:00 1996 Path: biosci!internet!biosci!not-for-mail From: biohelp (BIOSCI Administrator) Newsgroups: bionet.population-bio Subject: BIOSCI/bionet miniFAQ & Fundraiser Date: 11 Oct 1996 02:00:43 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 239 Sender: daemon@net.bio.net Distribution: world Message-ID: <199610110900.CAA23060@net.bio.net> NNTP-Posting-Host: net.bio.net (LAST REVISION: 30-JUL-95) This BIOSCI "miniFAQ" is designed to answer the questions that come up the *most frequently*. The main BIOSCI FAQ (Frequently Asked Questions) is accessible on the World Wide Web at URL http://www.bio.net/. If you can not find an answer to your question in this or other documentation, the BIOSCI technical support staff answers e-mail queries sent to biosci-help@net.bio.net We can only answer questions about the use of the newsgroups and mailing lists. We unfortunately do not have the staff to do Internet information searches or answer scientific questions. Please post those to the appropriate BIOSCI/bionet newsgroups. Contents: -------- 0) BIOSCI NEEDS YOUR SUPPORT!! 1) Using the WWW to access the BIOSCI/bionet newsgroups. 2) What to do about "spams," i.e., junk mail, ads, etc. 3) Examples of subscribing and unsubscribing to the mailing lists. 4) The BIOSCI user address and research interest directory. 0) BIOSCI NEEDS YOUR SUPPORT!! ------------------------------ BIOSCI's government funding has been expended, and we are now operating solely from advertising revenue that we have raised from our Web site at http://www.bio.net/. We need just a few minutes of your time to help us serve you. You can do two important things which will take very little time for you individually and will immensely help us continue to help you. First, please use our WWW system at http://www.bio.net/ to access the archives. You can post or reply to messages via your Web browser as described in item #1 below. Your usage helps attract sponsors. If you contact any of our sponsors, please be sure to thank them for supporting BIOSCI. It is critical for them to get this feedback if they are to continue their sponsorship for the long term. Second, if you work for a company or organization that provides products or services of interest to the biology community, please pass this message on to your marketing or marketing communications department or other appropriate group. Please ask them to help support BIOSCI by sponsoring our Web site and explain the uses and benefits of the system to the biology community. If they are interested, they can then contact us for further information at our tech support address, biosci-help@net.bio.net. 1) Using the WWW to access the BIOSCI/bionet newsgroups. -------------------------------------------------------- As of 10 December 1995, all BIOSCI/bionet full newsgroups are accessible through the World Wide Web (WWW) at URL http://www.bio.net. One can read and reply publicly or privately to both recent postings and archived messages through one's Web browser if it is configured properly to send e-mail. Each newsgroup is equipped with its own WAIS index. The main BIOSCI home page also has access to the BIO-JOURNALS Table of Contents database WAIS index and the BIOSCI user address database described in another item further below. 2) What to do about "spams," i.e., junk mail, ads, etc. ------------------------------------------------------- BIOSCI is a set of parallel USENET newsgroups (the "bionet" groups), mailing lists, and a hypermail archive at URL http://www.bio.net/. The same postings are distributed on all media (except for a small number of mailing-list-only groups at net.bio.net). Unfortunately it is becoming a despicable practice on the Internet (by a few people out to make a fast buck) to do automated mass postings to thousands of newsgroups and mailing lists. These attempts to grab free advertising are refered to as "spams" in the usual, somewhat boneheaded, net terminology. USENET is more susceptible to this practice, and many spams originate on the USENET groups and then are passed on to the mailing lists. However, spammers also get lists of mailing addresses and hit these too, so neither medium is immune. What should you do personally if you get junk mail? --------------------------------------------------- Just delete it and move on without reading it further. Filing a protest is becoming increasingly useless because spammers are often disguising the addresses where the messages are sent from. Unless you really understand Internet mail systems, your attempt at protest by sending replies to the message will often end up being sent to the address of an innocent person that the spammer is victimizing. What can BIOSCI/bionet do to protect its newsgroups? ---------------------------------------------------- The only solution currently available is to moderate the newsgroup. If this newsgroup is already moderated, then you are in good shape. Moderation protects the USENET distribution from about 95% of the spams that are being sent to date and protects the mailing lists completely. Moderation means, however, that someone has to take the time to review each message before it goes out. We have set up software here that simply allows the moderator to forward to an address at net.bio.net messages that (s)he wishes to have distributed. This takes no more time than that needed to read the message and pass it on, say about 1 min. per message. Most newsgroups currently have a discussion leader who is responsible for their newsgroup. The discussions leaders and their e-mail addresses are listed in the BIOSCI Information Sheet which is available on the Web at http://www.bio.net/. If a newsgroup is being hit with too many junk postings, please contact the discussion leader for that group and see if there is interest in moderating the group. Please do not assume that by simply posting a complaint to the newsgroup itself, anyone on the BIOSCI staff will act on your complaint. With close to 100 newsgroups to run, the BIOSCI staff has to rely on the discussion leaders of each newsgroup to report problems directly to us at biosci-help@net.bio.net. We will moderate any of our newsgroups if the discussion leader tells us that the readership of the group wishes to do so and if a moderator is willing to do the work. For most BIOSCI/bionet groups, this entails only a few minutes of work each day. Moderating a newsgroup will resolve probably 95% of the junk postings on the USENET distribution. Unfortunately there are easy ways for determined spammers to override the moderation mechanism on USENET, but we can protect our e-mail subscribers from unwanted postings if the newsgroup is moderated. You can also access our newsgroups over the WWW at URL http://www.bio.net. While this Web interface will not stop spammers from trying to post to the groups, this will give you yet another way, besides using USENET news, to keep the junk out of your personal mail files. For those of you with local USENET news systems, the Web interface will also give you faster access to new newsgroups and recent postings. 3) Examples of subscribing and unsubscribing to the mailing lists. ------------------------------------------------------------------ PLEASE NOTE: The BIOSCI management does NOT act on subscription/unsubscription requests that are posted improperly to the newsgroups and mailing lists. People who do this only bother everyone on the lists to no avail. Please be sure to follow the proper procedures below. Gory details are in the BIOSCI Information sheets on the Web at http://www.bio.net. Below we give an example utilizing the METHODS-AND-REAGENTS list at both of our two BIOSCI sites: Users in the Americas and Pacific Rim countries who use the BIOSCI ------------------------------------------------------------------ node at computer net.bio.net: ---------------------------- A) Determine the "listname" which is the <=8 character mail address ^^^^^^^^^^^^^ for the group. These can be found in the BIOSCI Info. Sheet. For the METHODS-AND-REAGENTS group the mailing address is methods@net.bio.net. The listname is the portion of the address to the left of the @ sign, i.e., "methods". The listname is used with the "subscribe" and "unsubscribe" commands illustrated below. B) Mail all commands in the body of a mail message addressed to biosci-server@net.bio.net. Do NOT send commands to the newsgroup posting addresses! Leave the Subject: line blank, any text on it will be ignored. C) In the body of your message put one or more of the following commands with an "end" command on the last line, e.g., subscribe methods unsubscribe methods end Do NOT put your e-mail address or other text on these lines. The server only allows you to cancel your subscription if the address on your mail header matches the address on our mailing list. Please ask for help at biosci-help@net.bio.net if your address has changed, e.g., if you know you are on the list but the server tells you that you are not a member. Users in Europe, Africa, and Central Asia who use the BIOSCI node at -------------------------------------------------------------------- computer daresbury.ac.uk (also known as dl.ac.uk): ------------------------------------------------- To subscribe and unsubscribe to/from the BIOSCI lists, you need to specify the full USENET newsgroup name with "bionet-news." prepended. The USENET newsgroup names are listed in the BIOSCI Information sheet on the Web at http://www.bio.net/. For the METHODS-AND-REAGENTS list the USENET newsgroup name is bionet.molbio.methds-reagnts, thus the appropriate commands are sub bionet-news.bionet.molbio.methds-reagnts unsub bionet-news.bionet.molbio.methds-reagnts These commands are included in a message addressed to mxt@dl.ac.uk, NOT to the newsgroup mailing addresses. As usual, include the text in the body of the message as text on the Subject: line is ignored. To unsubscribe from all the lists at the UK node, use unsub bionet-news Please note that if the address in the list is different than the one in your mail message header, you will not be able to unsubscribe by this method. If you have problems, please mail biosci@daresbury.ac.uk. 4) The BIOSCI user address and research interest directory. ----------------------------------------------------------- Please take this opportunity to add your name, address, and research interest information to the BIOSCI User Address Database if you have not already done so. You can fill out the address form directly through our Web page at URL http://www.bio.net/adrform.html. The address database is reindexed nightly for WWW access (the URL is http://www.bio.net/). If you are not directly on the Internet but can reach it by e-mail, please use our waismail server to access the user directory. waismail use is described above. You can also request a user address form by e-mail from biosci-help@net.bio.net. Please check your database entry from time-to-time to see if your address information is still up-to-date. Because of our limited personnel resources, we ask that you resubmit a *complete* form to revise your entry; we only replace complete entries and do not have resources to edit old forms. Sincerely, Dave Kristofferson BIOSCI/bionet Manager biosci-help@net.bio.net From owner-population-bio@net.bio.net Mon Oct 14 23:00:00 1996 Path: biosci!agate!usenet From: John Taylor Newsgroups: bionet.population-bio Subject: Postdocs in Fungal Population Genetics Date: Tue, 15 Oct 1996 16:43:23 -0700 Organization: University of California, Berkeley Lines: 68 Message-ID: <32642198.4248@violet.berkeley.edu> Reply-To: jtaylor@violet.berkeley.edu NNTP-Posting-Host: kos5mac22.berkeley.edu Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0 (Macintosh; I; PPC) POST DOCTORAL POSITIONS IN FUNGAL POPULATION GENETICS AT BERKELEY. We are searching for two post doctoral reseserchers to investigate the population biology of two fungi responsible for human disease, Coccidioides immitis and Histoplasma capsulatum. Our project involves the use of nucleic acid variabililty and population genetics to study the natural history and epidemiology of fungi. Candidates for both positions should have experience in evolutionary biology using molecular techniques, and must have a PhD degree. One new researcher should have a strong background in mycology, including experience in the cultivation of fungi. The other new researcher should have a strong background in population genetics. Some recent examples of our research in this area may be found in: Burt, A., D. A. Carter, G. L. Koenig, T. J. White, and J. W. Taylor. 1996. Molecular markers and sex in the human pathogen Coccidioides immitis (Ascomycota). Proc. Natl. Acad. Sci. 93:770-773. Carter, D.A., A. Burt, J.W. Taylor, G.L. Koenig and T.J. White. 1996. Clinical isolates of Histoplasma capsulatum from Indianapolis have a recombining population structure. J. Clinical Microbiology 34:2577-2584 Burt, A., Carter, D.A., White, T.J., and Taylor, J.W. 1994. DNA sequencing with arbitrary primer pairs. Molecular Ecology 3:523-525. Bowman, B. H., T. J. White, and J. W. Taylor. 1996. Evolutionary relationships of human pathogenic fungi: multiple origins of pathogenicity in the fungal order Onygenales. Molec. Phylog. Evol. 6:89-96. Funding is from the National Institutes of Health and will support at least two years of research for both positions. The positions are available now. Interested researchers should contact: Dr. John W. Taylor Department of Plant and Microbial Biology 111 Koshland Hall Unversity of California Berkeley, CA 94720-3102 jtaylor@violet.berkeley.edu Dr. Thomas J. White c/o Ms. Kathleen Gonzales CHORI 747 52nd ST Oakland, CA 94609-1809 510-428-3511 ph 510-428-3608 fax THOMAS.WHITE@roche.com The University of California is an affirmative action/equal opportunity employer. -- ____________________________________ From: John Taylor, Department of Plant and Microbial Biology, 111 Koshland Hall, University of California, Berkeley, CA 94720-3102 Tel (510) 642-5366, Fax (510) 642-4995, jtaylor@violet.berkeley.edu From owner-population-bio@net.bio.net Mon Oct 14 23:00:00 1996 Path: biosci!agate!spool.mu.edu!newspump.sol.net!howland.erols.net!newsfeed.internetmci.com!newsfeeder.servtech.com!post.servtech.com!saltcitysw.syr.servtech.com!saltcity From: saltcity@servtech.com (kim pruitt) Newsgroups: bionet.population-bio Subject: Plasmid Tracker Now Available Date: Tue, 15 Oct 1996 13:06:33 UNDEFINED Organization: Salt City Software Lines: 12 Message-ID: NNTP-Posting-Host: saltcitysw.syr.servtech.com X-Newsreader: Trumpet for Windows [Version 1.0 Rev B final beta #1] ANNOUNCING: Plasmid Tracker for Windows is now available. Plasmid Tracker is designed to help organize your bacterial freezer stocks. Some of the main features include: import/export, fully customizable, maintain multiple databases and merge them into a lab master database as needed, computer generated restriction map diagrams, search and find. For additional information and to download a FREE DEMO see URL: http://www.servtech.com/public/saltcity Kim D. Pruitt Salt City Software e-mail: 70761.2216@compuserve.com From owner-population-bio@net.bio.net Wed Oct 16 23:00:00 1996 Path: biosci!specle.chel.su!Specle From: Specle@specle.chel.su ("Michael A. Sniggin") Newsgroups: bionet.population-bio Subject: We Need Your HELP!!! Date: 17 Oct 1996 09:34:48 -0700 Organization: OOO Yguralspecavtomatick Lines: 28 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Gentlemen! Please, read this message over - this is not an ads or something like that. We are living in the South Urals, Russia and we are trying to connect our society, our people to the Internet by new technologies - just to have normal conditions to work with this Great Net. What we have now is just a mockery - sometimes 25 bytes/sec (!!!). But new equipment is very expensive. So we are trying to collect the sum we need by donations of persons holding the same views. If you sympathise our ideas and consider it possible to send us some money - it would be accepted with warm gratitude. We would be also very grateful to all advises too, our mail - specle@specle.chel.su Thank you for reading this message over, and - forgive us for taking your time. Yours virtually, Yang businessmen. Please transfer ANY sum to the: BENEFICIARY: Lazarev Yuri Ivanovich, Russia ACCOUNT # 008100072 With Savings Bank Of Russian Federation (SBERBANK) C.H.I.P.S. Number 3212333 SWIFT Code - SABRRUMM Kurchatovskoe Branch 8053 In Favour Account # 7207001394/001 (for USD) # 7207000088/048 (for DM) From owner-population-bio@net.bio.net Thu Oct 17 23:00:00 1996 Path: biosci!cgi.nsk.su!kuznecov From: kuznecov@cgi.nsk.su (Kuznecov S.B.) Newsgroups: bionet.population-bio Subject: genetics,population analysis, and ecology of geese Date: 18 Oct 1996 01:31:13 -0700 Organization: Institute of Cytology & Genetics Lines: 20 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Now we are making the population analysis of lesser snow geese from Wrangel Island, Russia. We use the electrophoresis of blood proteins. We are very interested in contacts with everybody who studies the population analysis, genetics, and ecology of geese (lesser snow geese, white fronted geese, bean geese and so on ). If there is anybody working with these subjects please contact us by e-mail: kuznecov@cgi.nsk.su We are also looking for web sites in which we can get the useful information about geese genetics and ecology. Thank you for your time and assistance. Ph.D. Sergei B. Kuznetsov Denis M. Larkin Institute of Cytology and Genetics SB RAS Novosibirsk 630090 Russia Tel: (3832)351245 FAX: (3832)356558 From owner-population-bio@net.bio.net Sat Oct 19 23:00:00 1996 Path: biosci!juno.com!rkurtz1 From: rkurtz1@juno.com (Richard M Kurtz) Newsgroups: bionet.population-bio Subject: High school student question Date: 19 Oct 1996 19:46:30 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 13 Sender: daemon@net.bio.net Distribution: world Message-ID: <19961019.224446.18558.2.rkurtz1@juno.com> NNTP-Posting-Host: net.bio.net To whom it may concern, I have a high school student in a science research class who is doing a research project on population control of aphids by lady bug beetles. She is interested in whether the milkweed plant provides protection for the aphids through the plant juice. Does anyone know of work being done in this area. We have some insects and plants but will need more. Any sources out there? Any help would be appreciated Richard, Huntington High School, Long Island, NY From owner-population-bio@net.bio.net Sun Oct 20 23:00:00 1996 Path: biosci!agate!howland.erols.net!news-peer.gsl.net!news.gsl.net!news-stkh.gsl.net!news.gsl.net!nntp-oslo.UNINETT.no!nntp-trd.UNINETT.no!nntp.uio.no!biomar16.uio.no!ejorde From: ejorde@biomar16.uio.no (Per Erik Jorde) Newsgroups: bionet.population-bio Subject: Re: genetics,population analysis, and ecology of geese Date: 21 Oct 1996 07:47:09 GMT Organization: University of Oslo, Norway Lines: 24 Message-ID: <54f9pt$s0m@ratatosk.uio.no> References: NNTP-Posting-Host: biomar16.uio.no In article , kuznecov@cgi.nsk.su (Kuznecov S.B.) writes: |> Now we are making the population analysis of lesser snow geese from Wrangel |> Island, Russia. We use the electrophoresis of blood proteins. We are very |> interested in contacts with everybody who studies the population analysis, |> genetics, and ecology of geese (lesser snow geese, white fronted geese, |> bean geese and so on ). If there is anybody working with these subjects |> please contact us by e-mail: kuznecov@cgi.nsk.su |> We are also looking for web sites in which we can get the useful information |> about geese genetics and ecology. |> If you have not done so already, you should take a look on Fred Allendorf's excellent searchable bibliographic database "BIBLIOGRAPHY OF GENETIC VARIATION IN NATURAL POPULATIONS" at: http://entity.lib.umt.edu/localdbi/allendorf/allendorf.html There are several papers on geese genetics listed. Per Erik Jorde Division of Zoology, University of Oslo, Norway P.O.Box 1050 Blindern, N-0316 Oslo, Norway p.e.jorde@bio.uio.no Fax: +47 22854605 From owner-population-bio@net.bio.net Mon Oct 21 23:00:00 1996 Path: biosci!rutgers!csn!nntp-xfer-1.csn.net!magnus.acs.ohio-state.edu!lerc.nasa.gov!purdue!mozo.cc.purdue.edu!macg417o.bio.purdue.edu!user From: myaber@bilbo.bio.purdue.edu (Carolina Yaber) Newsgroups: bionet.population-bio Subject: field assistant needed in Venezuela for Spring '97 Date: Tue, 22 Oct 1996 16:34:28 -0600 Organization: Purdue University Lines: 99 Message-ID: NNTP-Posting-Host: macg417o.bio.purdue.edu I would like to thank all of you who have shown interest in the project. I now want to be more specific about the project and the living conditions in Venezuela, as well as the conditions for the field assistance. First I will present a summary of the project: PROJECT SUMMARY We propose to expand long-term studies of populations of tropical wrens (Campylorhynchus nuchalis) in the Venezuelan savanna to understand the interactions of local populations and their consequences for long-term metapopulation persistence. The study system comprises 5 populations with histories of 4-20 years; they vary in isolation as a result of naturally patchy vegetation, and the set is isolated on a larger scale by agriculture. These populations are representative of social, philopatric, tropical vertebrates in heterogeneous landscapes. We will use behavioral, demographic, and genetic data to test the hypothesis that assessment of viability requires study of birth, death, and migration on a scale encompassing multiple interacting populations. We will integrate field, laboratory, and computer modeling approaches. The general question we are addressing concerns the importance of dispersal tendencies for population dynamics, especially in regards to whether dispersal is critical to metapopulation persistence and genetic structure. Location and living conditions in the Ranch (Hato Masaguaral): The ranch is located 4 hours (driving) from the capital city (Caracas). The nearest city is Calabozo. This city is small but has a telephone and a place where we can send and receive faxes. It also has several grocery stores (we usually use just one) and one theater (sometimes just Rambo-type movies). The ranch does not have phones. It has electricity, but not hot water, and the houses are equipped with the basics (kitchen and bathroom). There are some beds, and hammocks can be easily obtained in Calabozo. I sleep in a hammock because of all the normal animals and insects usually found in the field. The months of January-May are the dry season. The weather is hot but breezy---no mosquitos, but there are ticks. The months of June-July are wet and humid. It is hotter, and there are a lot of mosquitos and horseflies are present. During these months, the ranch oftyen floods so rubber boots are necessary (and a lot of clothes---we ususally get wet every day). Conditions for the Field Assistance: I will be working intensively during the months of January and February. March-April and beginning of May will not be so busy, and I will be traveling back and forth between the ranch and Caracas. Assistance during these months would be very helpful, but (I think) I can survive without it . During the last days of May-June and July, I will be working intensively again and staying on the ranch. The help that I am looking for does not have to be for the whole 8 months. I will need somebody who can promise to stay during January and February and the same person or somebody else during May-July, or perhaps for the 8 months??? The assistance is VOLUNTARY. This means that I will not be able to help financially with the cost of the ticket (USA-Venezuela), and I will not be able to pay a salary. I WILL PAY FOR: basic food and housing during the time the person stays on the ranch. What will the Field Assistant be doing? The work in the field will require some knowledge about netting birds. We will do this almost every morning if the weather collaborates with us. We will be out before sunrise, since the nets and equipment for netting have to be ready before the birds wake up. We will band the birds and take blood samples. Previous experience would be great, but training on the ranch is possible. We will be censusing the birds, identifying them based on colored bands, and counting the number of individuals and individuals that duet. During the breeding season (May-July) we will localizing the nests, and counting the number of individuals, number of breeding attempts and failures, and number of juveniles. Animals on the ranch The animals that you can see on the ranch are countless. You can see anything from pumas to snakes, frogs and crocodiles. There are free caimans which you can see more frequently (and have encounters with) during the wet season. They do not attack people except during their breeding season, which starts in mid-August. The only poisonous snake present is the rattlesnake, althoug I have not seen one in 4 years of working on the ranch. This is a short summary of most of the details about what the assistant will be doing and the living conditions on the ranch. If you are still interested, please email me at: myaber@bilbo.bio.purdue.edu. Or call (317) 494-4726 and ask for Carolina. Thanks again, and take care. Carolina Yaber Purdue University Department of Biological Sciences 1392 Lilly Hall West Lafayette, IN 47907 Fax:(317) 4961189 Phone (317) 4944726 email: myaber@bilbo.bio.purdue.edu From owner-population-bio@net.bio.net Tue Oct 22 23:00:00 1996 Path: biosci!agate!howland.erols.net!vixen.cso.uiuc.edu!ais.net!cdc2.cdc.net!newsfeed.concentric.net!news2.acs.oakland.edu!cwis-20.wayne.edu!usenet From: Gerard Tromp Newsgroups: bionet.population-bio Subject: comparison of phylogenetic distance estimates Date: Tue, 22 Oct 1996 20:55:26 -0400 Organization: CMMG, Wayne State University Lines: 23 Message-ID: <326D6CFE.6A4B@sanger.med.wayne.edu> NNTP-Posting-Host: sanger.med.wayne.edu Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 3.0Gold (X11; I; SunOS 5.4 sun4m) Greetings, Apologies if this is a strange question. I am somewhat familiar with statistics, so one of my colleagues asked me how to compare phylogenetic distance estimates. Specifically, the colleague generated some phylogenetic data and analyzed it with MEGA. She enquired if there was a statistical test for the comparison of the ratios of non-synonymous to synonymous substitution rates. That is, how does one decide if a group of one or more ratios differ from others? In the summary of the data that I saw, there was no evidence of variance, something that would be necessary for all the tests that I know of. I assume that there are tests designed for this purpose. Could someone enlighten me? Gerard -- %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% Gerard Tromp, Ph.D. CMMG, Wayne State University vox: 313-577-8773 3116, Scott Hall fax: 313-577-5218 540 E Canfield Ave e-mail: tromp@sanger.med.wayne.edu Detroit, MI 48201 gtromp@cmb.biosci.wayne.edu From owner-population-bio@net.bio.net Tue Oct 22 23:00:00 1996 Path: biosci!CNS.BU.EDU!cas-cns From: cas-cns@CNS.BU.EDU (CAS/CNS) Newsgroups: bionet.population-bio Subject: Special CAS/CNS Colloquium Date: 23 Oct 1996 07:29:40 -0700 Organization: Boston University - Cognitive and Neural Systems Lines: 40 Sender: daemon@net.bio.net Distribution: world Message-ID: <199610231414.KAA16967@cns.bu.edu> NNTP-Posting-Host: net.bio.net SPECIAL CAS/CNS COLLOQUIUM Dr. Werner Schneider Experimental Psychology Department Ludwig-Maximilians University Munich, Germany "VAM 2: A Neuro-Cognitive Visual Attention Model for Task-Dependent Control of Visual-Based Segmentation, Object Recognition, and Spatial-Motor Action" Tuesday, October 29, 1996 2:00pm 677 Beacon Street Room B02 Refreshments to follow the talk in Room B01 ABSTRACT: The first part of the talk will introduce four functions of visual control mechanisms ("visual attention"), namely selection-for-object-recognition, selection-for-spatial-motor-action, selective segmentation, and selective categorization. It will be suggested that task-dependent modulation of competitively organized visual categorization processes at all levels of ventral and dorsal streams are basic to these functions. The second part of the talk will specify the task-dependent control mechanisms. According to the model proposed, task-dependent activation spreads from visual brain modules computing target-relevant visual attributes to V1/V2 and finally to low-level parietal areas that compute regions of objects. These parietal regions in turn control---based on activation (pertinence)---an "attentional window" which selects the low-level visual representations of one object for recognition and for the preparation of spatial-motor actions (such as a saccade and a grasping movement) in higher-level visual areas. The last part will relate single cell data to the suggested attentional control architecture. From owner-population-bio@net.bio.net Tue Oct 22 23:00:00 1996 Path: biosci!bcm.tmc.edu!cs.utexas.edu!howland.erols.net!cam-news-hub1.bbnplanet.com!cam-news-feed1.bbnplanet.com!charlotte.wellesley.edu!sallie.wellesley.edu!jbeckert From: jbeckert@sallie.wellesley.edu Newsgroups: bionet.population-bio Subject: SEAGRASS INQUIRY Date: 23 OCT 96 13:35:23 GMT Organization: WELLESLEY COLLEGE Lines: 49 Message-ID: <23OCT96.13352397@sallie.wellesley.edu> NNTP-Posting-Host: sallie.wellesley.edu Does anyone out there work with seagrasses? I am in immediate need of some information... I understand Zostera marina has two forms, annual and perennial. I have read that the annual type is found largely in areas subject to ice scouring in the winter, and that the perennial form is generally found in deeper waters less likely to be disturbed by ice. If this is so, how does seed output of the perennials compare to that of the annuals? Are seeds able to germinate and seedlings grow amid the dense rhizomes of the perennials? How genetically diverse is the average patch of perennials? Are Zostera seeds dormant over winter, germinating in the spring? Do the annual types also grow clonally, or does this form of growth require more than a single season? I have read conflicting ideas on whether or not the two forms are genetically different. Have any recent studies been made on this? I have also read that Z. marina seeds do not usually disperse more than a few meters from the parent plants. I am puzzled -- what could be the strategy of such a dispersal system? Are enough seeds carried off on detached reproductive structures to disperse the seeds effectively? Are there seed predators, and do they take a significant part of the seed crop? ALSO -- I would like to know whether any of the tropical seagrasses exhibit similar annual/perennial differences. If so, is this also related to disturbance (e.g., storm damage?)? Do the tropical species customarily grow in deeper water than the temperate, perhaps because of greater water clarity? Are they also clonal? What is the situation on seed production and dispersal in the tropical species? I would *greatly* appreciate any information anyone might be able to give me, and/or any suggestions of primary literature relating to any of these questions. Please respond directly to me at JBECKERT@LUCY.WELLESLEY.EDU Thank you very much!! Jan Beckert From owner-population-bio@net.bio.net Wed Oct 23 23:00:00 1996 Path: biosci!daresbury!nntp-trd.UNINETT.no!online.no!Oslo2.Norway.EU.net!Norway.EU.net!sn.no!www.nntp.primenet.com!nntp.primenet.com!howland.erols.net!vixen.cso.uiuc.edu!uwm.edu!newsspool.doit.wisc.edu!news.doit.wisc.edu!news From: markb@ravel.zoology.wisc.edu (Mark E. Berres) Newsgroups: bionet.population-bio Subject: Re: comparison of phylogenetic distance estimates Date: 24 Oct 1996 13:42:11 GMT Organization: University of Wisconsin, Madison Lines: 48 Message-ID: <54nrnj$v6e@news.doit.wisc.edu> References: <326D6CFE.6A4B@sanger.med.wayne.edu> NNTP-Posting-Host: ravel.zoology.wisc.edu Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii X-Newsreader: knews 0.9.8 In article <326D6CFE.6A4B@sanger.med.wayne.edu>, Gerard Tromp writes: > Greetings, > > Apologies if this is a strange question. I am somewhat familiar with > statistics, so one of my colleagues asked me how to compare phylogenetic > distance estimates. > Specifically, the colleague generated some phylogenetic data and > analyzed it with MEGA. She enquired if there was a statistical test for > the comparison of the ratios of non-synonymous to synonymous > substitution rates. That is, how does one decide if a group of one or > more ratios differ from others? In the summary of the data that I saw, > there was no evidence of variance, something that would be necessary for > all the tests that I know of. > I assume that there are tests designed for this purpose. Could someone > enlighten me? > > Gerard You are in luck. An easy to use application which does precisely what you want is available. First consult Muse, SV and BS Gaut (1994). A likelihood approach for comparing synonymous and nonsynonymous nucleotide substitution rates with application to the chloroplast genome. Mol. Biol. Evol. 11:715-724. and Muse, SV (1996) Estimating synonymous and nonsynonymous substitution rates. Mol. Biol. Evol. 13:105-114. for background explanations of the model. Since I cannot remember the ftp site where I obtained the software email Spencer Muse directly at muse@kurtz.bio.psu.edu (or SVM1@psuvm.psu.edu). The name of the program that calculates the quantities described in the above papers is called syndist. Mark -- Mark E. Berres Birge Hall Office, Room 441 Department of Zoology 430 Lincoln Drive Department of Genetics Madison, WI. 53706-1313 University of Wisconsin at Madison Ph: (608)-265-6427 Fx: (608)-265-6320 From owner-population-bio@net.bio.net Thu Oct 24 23:00:00 1996 Path: biosci!agate!spool.mu.edu!howland.erols.net!torn!ccshst05.uoguelph.ca!ccshst01!mwstewar From: mwstewar@uoguelph.ca (Marg W Stewart) Newsgroups: bionet.population-bio Subject: Postdoc - Human/Ecosystem Health Date: 24 Oct 1996 16:27:14 GMT Organization: University of Guelph Lines: 53 Message-ID: <54o5d2$co7@ccshst05.cs.uoguelph.ca> NNTP-Posting-Host: ccshst01.cs.uoguelph.ca Summary: Postdoc position available in Ecosystem Health X-Newsreader: TIN [version 1.2 PL2] Keywords: ecosystem health, human health, diagnostics, environment POST-DOCTORAL FELLOWSHIP in ECOSYSTEM DIAGNOSTICS with the Tri-Council Eco-Research Chair Program in Ecosystem Health University of Guelph Applications are invited for a Post-Doctoral Fellowship in Ecosystem Diagnostics with the Tri-Council Eco-Research Chair Program in Ecosystem Health at the University of Guelph, Guelph, Ontario, Canada. The Chair Program is sponsored by the three National Research Councils of Canada, in partnership with federal and provincial agencies. The Chair Program fosters an integrative approach to assessing changes in environment through an Ecosystem Health perspective. Its goals are to integrate the socioeconomic, biophysical and human health dimensions of environmental change within an evolving framework for assessment and management of the environment. The Chair Program seeks to develop transdisciplinary research, integrating the social, natural and health sciences. The candidate will be expected to develop an innovative research program which draws upon methodologies in the health sciences in application to evaluating ecosystem transformations. The research group comprises the Chairholder, three post-doctoral fellows and a farming systems scientist and several graduate students. Potential areas of research include: Human health implications of environmental change Application of diagnostic protocols from health sciences to ecosystem assessment Human health costs of environmental change Education and experience in classification and diagnosis of disease is pertinent. Salary: $30,000 per year. Letters of application, with a curriculum vitae and names and addresses of three referees, should be sent by November 15, 1996 to: David J. Rapport Tri-Council Eco-Research Chair in Ecosystem Health Room 205, Blackwood Hall University of Guelph Guelph, Ontario Canada N1G 2W1 fax: (519) 763-4686 email: drapport@envsci.uoguelph.ca From owner-population-bio@net.bio.net Fri Oct 25 23:00:00 1996 Path: biosci!rutgers!news.sgi.com!mr.net!www.nntp.primenet.com!nntp.primenet.com!feed1.news.erols.com!howland.erols.net!torn!ccshst05.uoguelph.ca!ccshst01!mwstewar From: mwstewar@uoguelph.ca (Marg W Stewart) Newsgroups: bionet.population-bio Subject: Postdoc in Ecosystem Health Date: 25 Oct 1996 13:59:36 GMT Organization: University of Guelph Lines: 53 Message-ID: <54qh48$443@ccshst05.cs.uoguelph.ca> NNTP-Posting-Host: ccshst01.cs.uoguelph.ca Keywords: ecosystem health, human health, diagnostics, environment X-Newsreader: TIN [version 1.2 PL2] POST-DOCTORAL FELLOWSHIP in ECOSYSTEM DIAGNOSTICS with the Tri-Council Eco-Research Chair Program in Ecosystem Health University of Guelph Applications are invited for a Post-Doctoral Fellowship in Ecosystem Diagnostics with the Tri-Council Eco-Research Chair Program in Ecosystem Health at the University of Guelph in Guelph, Ontario, Canada. The Chair Program is sponsored by the three National Research Councils of Canada, in partnership with federal and provincial agencies. The Chair Program fosters an integrative approach to assessing changes in environment through an Ecosystem Health perspective. Its goals are to integrate the socioeconomic, biophysical and human health dimensions of environmental change within an evolving framework for assessment and management of the environment. The Chair Program seeks to develop transdisciplinary research, integrating the social, natural and health sciences. The candidate will be expected to develop an innovative research program which draws upon methodologies in the health sciences in application to evaluating ecosystem transformations. The research group comprises the Chairholder, three post-doctoral fellows and a farming systems scientist and several graduate students. Potential areas of research include: Human health implications of environmental change Application of diagnostic protocols from health sciences to ecosystem assessment Human health costs of environmental change Education and experience in classification and diagnosis of disease is pertinent. Salary: $30,000 per year. Letters of application, with a curriculum vitae and names and addresses of three referees, should be sent by November 15, 1996 to: David J. Rapport Tri-Council Eco-Research Chair in Ecosystem Health Room 205, Blackwood Hall University of Guelph Guelph, Ontario Canada N1G 2W1 fax: (519) 763-4686 email: drapport@envsci.uoguelph.ca From owner-population-bio@net.bio.net Sun Oct 27 22:00:00 1996 Path: biosci!rutgers!news.sgi.com!news-peer.gsl.net!news.gsl.net!portc01.blue.aol.com!newsstand.cit.cornell.edu!news.acsu.buffalo.edu!acsu.buffalo.edu!usenet From: hlasker@acsu.buffalo.edu Newsgroups: bionet.population-bio Subject: Molecular Ecology - Asst. Prof. position Date: 28 Oct 1996 16:51:28 GMT Organization: University at Buffalo Lines: 38 Message-ID: <552oag$oak@prometheus.acsu.buffalo.edu> NNTP-Posting-Host: lasker.bio.buffalo.edu Mime-Version: 1.0 Content-Type: Text/Plain; charset=US-ASCII NNTP-Posting-User: hlasker X-Newsreader: WinVN 0.99.7 Molecular Ecology - Assistant Professor The Department of Biological Sciences, State University of New York at Buffalo invites applications for a tenure track position at the level of assistant professor starting in September 1997. We seek an individual working in the area of MOLECULAR ECOLOGY, whose research addresses ecological and evolutionary questions using molecular genetic techniques such as manipulating the genome and following genetic markers within populations and species. The department has active research groups in ecology and molecular biology (including plant molecular biology) and we have identified molecular ecology as an area of future growth. The successful candidate will be expected to develop an active externally funded research program and contribute to undergraduate and graduate courses in ecology including a course in molecular ecology. Candidates should have a Ph.D. and two years of post-doctoral or equivalent experience. Applications, including a curriculum vitae, statement of research and teaching interests, and three letters of recommendation should be submitted to: Dr. Howard R. Lasker Molecular Ecology Search Committee Department of Biological Sciences State University of New York at Buffalo Buffalo, NY 14260-1300. Application review will begin December 15, 1996. Information about the Department and the University can be viewed at: http://wings.buffalo.edu/academic/department/fnsm/bio-sci/index.html. The State University of New York is an Equal Opportunity/Affirmative Action Employer, and encourages applications from minorities, women, and the disabled. No applicant shall be discriminated on the basis of age, creed, color, disability, nation of origin, religion, ethnicity, sex, sexual orientation, marital or veteran status. From owner-population-bio@net.bio.net Sun Oct 27 22:00:00 1996 Path: biosci!agate!howland.erols.net!EU.net!main.Germany.EU.net!Dortmund.Germany.EU.net!news-intern From: feeser@ikarus.ab.eunet.de (Stefan Feeser) Newsgroups: bionet.population-bio Subject: Existing a zoology-group Date: Mon, 28 Oct 1996 08:51:46 GMT Organization: Customer of EUnet Germany; Info: info@Germany.EU.net Lines: 11 Message-ID: <551s5l$ons@news.Dortmund.Germany.EU.net> NNTP-Posting-Host: peu1-116.f.eunet.de X-Newsreader: Forte Free Agent v0.46 Hello, my name is Stefan and I'm a student of forestry. Because my intrests are zoology and wildlife-managment, I'm searching for a group bionet.zoology. For some other persons is this determined in- trested too. If it exist such group, please write too. Bye, Stefan From owner-population-bio@net.bio.net Tue Oct 29 22:00:00 1996 Path: biosci!rutgers!uwm.edu!cs.utexas.edu!howland.erols.net!www.nntp.primenet.com!nntp.primenet.com!dispatch.news.demon.net!demon!netcom.net.uk!sunsite.doc.ic.ac.uk!yama.mcc.ac.uk!bignews.shef.ac.uk!usenet From: V J Street Newsgroups: bionet.population-bio Subject: dna fingerprinting Date: Wed, 30 Oct 1996 14:55:55 +0000 Organization: Molecular Biology & Biotechnology, University of Sheffield , UK Lines: 6 Message-ID: <32776C7B.1C6A@shef.ac.uk> NNTP-Posting-Host: pc113047.shef.ac.uk Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 2.02 (Win16; I) I am in my third year at the university of Sheffield and am carrying out my dissertation on the validity of DNA fingerprinting. I really need some information on the new NRC report that came out in may of this year. If anyone can help me out i would be very grateful. Thankyou, Vicki Street From owner-population-bio@net.bio.net Wed Oct 30 22:00:00 1996 Path: biosci!daresbury!not-for-mail From: Alexy Eroshkin Newsgroups: bionet.population-bio Subject: ProAnWin - Protein Analyst for Windows available at IUBio archive Date: 31 Oct 1996 11:30:53 -0000 Organization: State Research Center of Virology & Biotechnology VECTOR Lines: 37 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <55a2ld$jj1@mserv1.dl.ac.uk> Original-To: pop-bio@dl.ac.uk Our recent program ProAnWin, Protein Analyst for Windows 3.11/95, is now available at iubio.bio.indiana.edu, in directory /molbio/ibmpc/ as paw.exe. Access to iubio by ftp, http, and gopher methods are supported. ProAnWin is an application for multiple protein sequence alignment (automatic and manual), comparative sequence analysis, studying protein structure-activity (genotype - phenotype) relationships and designing site-directed mutagenesis (with 3D structire viewer). The program does: input of sequences from several formats (SWISS-PROT, PIR, FASTA, GCG, CLUSTAL) and 3D structure in PDB format; flexible multiple protein sequences alignment and threading sequences into known 3D structure (ClustalV + manual alignment); input of user-defined protein activities, properties or related phenotypes (with possibility to transform activity: log(x), 1/x, etc.); calculation of many characteristics (hydrophobicity, amphipathicity, etc.) of linear and spatial protein sites; fast multiple linear regression analysis of structure-activity relationships (up to eight independent factors); activity prediction for untested or mutated proteins; data visualization (regression plots, 3D structures with sites highlighted, multiple alignments); displaying found sites on sequences and 3D structure. The program can be applied to analysis of various protein-related biological data, to prediction of activity (phenotype) of newly sequenced proteins and to simulation of protein-engineering experiments. ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ Alexey Eroshkin Research Institute of Molecular Biology E.mail: eroshkin@vector.nsk.su State Research Center of Virology and Tel: +7 (3832) - 647774 Biotechnology "Vector" Fax: +7 (3832) - 328831 Koltsovo, Novosibirsk Region 633159 Russia +++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++