From owner-schistosoma@net.bio.net Tue Oct 01 23:00:00 1996 Path: biosci!rz.uni-duesseldorf.de!greveld From: greveld@rz.uni-duesseldorf.de ("Dr. Christoph Grevelding") Newsgroups: bionet.organisms.schistosoma Subject: Forwarded message Date: 2 Oct 1996 00:48:21 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 28 Sender: daemon@net.bio.net Distribution: world Message-ID: <199610020747.AAA15783@net.bio.net> Reply-To: "Dr. Christoph Grevelding" NNTP-Posting-Host: net.bio.net Dear Schisto members! This is a forwarded message from Dr. Carlos M. Finlay Institute Pedro Kouro Autopista Novia del Mediodoa, km 6, Havana City, Cuba. PO Box 601, Marianao 13. "The XIII Congress of the Latin American Federation of Parasitologists" will be held in Havana from 17 to 23 November 1997. The main topics concern the prevention and control of human, veterinary, plants and wild animal parasitic diseases and their vectors and intermediate host. All those wishing to attend or to obtain further information, please contact Dr. Carlos M. Finlay, President of the Organizing Committee: ciipk@infomed.sld.cu" Thanks in advance, Best regards, Dr. C. M. Finlay Chief of Parasitology Division Institute Pedro Kouro From owner-schistosoma@net.bio.net Wed Oct 02 23:00:00 1996 Path: biosci!vector.nsk.su!eroshkin From: eroshkin@vector.nsk.su (Alexy Eroshkin) Newsgroups: bionet.organisms.schistosoma Subject: ANNOUNCE ProAnWin: protein alignment and structure-activity analysis Date: 3 Oct 1996 04:21:58 -0700 Organization: State Research Center of Virology & Biotechnology VECTOR Lines: 263 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net To: schisto@net.bio.net From: Alexey Eroshkin Subject: ANNOUNCE ProAnWin: protein alignment and structure-activity analysis ************************************** ProAnWin - Protein Analyst for Windows ************************************** State Research Center of Virology and Biotechnology Koltsovo, Novosibirsk Region, 633159 Russia and Irina Pika, Anatoly Frolov, Vladimir Ivanisenko with Alexey Eroshkin are pleased to announce the availability of new MS Windows application for multiple protein sequence alignment, comparative sequences analysis, studying protein structure-activity (property/phenotype) relationships and designing site-directed mutagenesis. DESCRIPTION: ProAnWin studies the relationships between protein/peptide activity (or property or related phenotype) and characteristics of some regions in primary or tertiary structure of these molecules. Structure-activity analysis is based on the sequences of protein family, data on protein activity (pK, ED50, Km or any other) and, if available, 3D structure of one of these proteins (supposing the common 3D fold for all the homologs). The main aim is to find out the factors responsible for the variation of protein activities: location of activity-modulating site and important structural characteristics of the site. The program makes the following: input of sequences from several formats (SWISS-PROT, PIR, FASTA, GCG, CLUSTAL) and 3D structure in PDB format; flexible multiple protein sequences alignment and threading sequences into known 3D structure (ClustalV + manual alignment); input of user-defined protein activities, properties or related phenotypes (with possibility to transform activity: log(x), 1/x, etc.); calculation of many characteristics (hydrophobicity, amphipathicity, etc.) of linear and spatial protein sites; fast multiple (up to eight independent factors) linear regression analysis of structure-activity relationships; activity prediction for untested or mutated proteins; data visualization (regression plots, 3D pictures with sites highlighted, multiple alignments); displaying found sites on sequences and 3D structure. The program has two main related windows - with protein sequences and with 3D structure; any site highlighted in sequences is highlighted in 3D structure and vise versa. ProAnWin aligns complete set of sequences, subset or any selected block, providing thus possibility for iterative alignment that preserve some previously found blocks or those imposed from some biological data (active center, catalytic residues). The program can be applied to analysis of various protein-related biological data, to prediction of activity (phenotype) of newly sequenced proteins and to simulation of protein-engineering experiments. DATA EXAMPLES: 1. The family of disintegrins (proteins from snake venom) with tested activity. Name Sequence (part) Activity* 41 51 61 71 81 Trigramin alpha QCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNP 130 Albolabrin .............MKK..I..R............I........ 222 Elegantin ..AD.......R.KKKR.I..R....NP..R.T.Q..D....G 136 Flavoridin ..AD.......R.KKKTGI.......FP..R.T.L.ND...WN 100 Batroxastatin ..A........R.KGA.KI..R....NP..R.T.Q..D....R 133 Applagin ..A........L.MK.....-R.....VN.....I........ 50 Kistrin ........E..K.SRA.KI...P...MP..R.T.Q..D...YH 128 Echistatin alpha E.ES.P..RN.L.LK...I.LR.....M......LTCP..... 56 Bitistatin ..NH.E.....K.KKAR.........WN....T.K.SD..W.H 237 Bitan alpha ..NH.E.....R.KKA..........WN....T.K.SD..W.H 108 * - Activity is measured as the concentration of protein (in nM) required to 50% attenuation of platelet-rich plasma aggregation stimulated by adenosine-diphosphate. 2. The set of synthetic peptides with tested antimicrobial activity Name Activity* Peptide sequence Analog A2 400 GIHYLSHKSFSKFFAGVGKFTNS Analog A1 100 GIHYLSHKSFSKFFAGVQKFTNS Antisense P 60 GIHYLSHKSFSKFFCGVQKFTNS Analog B1 40 GIHYLSHKSFSKFFKGVQKFTNS Analog B2 40 GIHYLSHKSFSKFFKGVGKFTNS Magainin 2 20 GIGKFLHSAKKFGKAFVGEIMNS Analog C1 20 GIHKLSHKSFSKFFKGVQKFTNS Analog C2 20 GIHKLSHKSFSKFFKGVGKFTNS Analog P1 10 AIHNFAHKSFAKFFRAVKKFANA Analog P2 5 AIHNLAHKSLAKLLRAVKKLANA Analog P3 5 GIHNFAHKSFAKFFRAVKKFANS Analog M2 3 KIHKLAHKLLKKLLKAVKKLAKA * - Minimal inhibitory concentration (in mcg/ml) against E.coli 3. The set of unrelated peptides with tested immunogenicity. ------------------------------------------------- Protein Oncogene Sequence Immuno- region genicity* ------------------------------------------------- 409-425 C-SRC RLIEDNEYTARQGAKFP 4 468-482 C-SRC NREVLDQVERGYRMP 4 499-508 C-SRC WRRDPEERPT 4 001-018 V-KI-RAS MTEYKLVVVGASGVGKSA 5 119-135 V-KI-RAS DLPSRTVDTKQAQELAR 5 161-175 V-KI-RAS REIRQYRLKKISKEE 2 001-018 V-HA-RAS MTEYKLVVVGARGVGKSA 4 001-018 C-HA(EJ)-RAS MTEYKLVVVGAVGVGKSA 3 001-018 C-HA-RAS MTEYKLVVVGAGGVGKSA 5 029-044 V-HA-RAS VDEYDPTIEDSYRKQV 4 091-108 V-HA-RAS EDIHQYREQIKRVKDSDD 4 126-136 V-HA-RAS ESRQAQALARS 4 146-155 V-HA-RAS AKTRQGVEDA 5 160-179 V-HA-RAS VREIRQHKLRKLNPPDESGP 5 011-024 V-MYB PQESSKAGPPSGTT 4 033-047 V-MYB MAFAHNPPAGPLPGA 3 146-162 V-MYB DNTRTSGDNAPVSCLGE 4 168-186 V-MYB PSPPVDHGCLPEESASPAR 4 170-185 V-MYB PPVDHGCLPEESASPA 2 247-260 V-MYB PFHKDQTFTEYRKM 4 247-265 V-MYB PFHKDQTFTEYRKMHGGAV 4 541-555 V-FES RHSTSSSEQEREGGR 4 584-593 V-FES PEVQKPLHEQ 4 782-796 V-FES FLRTEGARLRMKTLL 4 840-846 V-FES SREAADG 0 893-905 V-FES ASPYPNLSNQQTR 3 901-913 V-FES NQQTREFVEKGGR 4 222-234 V-MYC PPTTSSDSEEEQE 0 323-334 V-MYC RTLDSEENDKRR 4 340-350 V-MYC ERQRRNELKLR 4 363-371 V-MYC NNEKAPKVV 1 389-403 V-MYC RLIAEKEQLRRRREQ 4 395-405 V-MYC EQLRRRREQLK 4 400-406 V-MYC RREQLKH 0 * logarithm of antipeptide antibody titers. 4. Phenotype-genotype correlations. Influenza A virus M2 protein from strains sensitive (labeled "sen") and resistant to amantadine or rimantadine ("res"). Strain Sensitivity Sequence (N-terminal part only) PR8-34 res MSLLTEVETPIRNEWGCRCNGSSDPLAIAANIIGILHLILWILDR MON88 res ....................D.................T...... LEN3-83 res ..........................T...........T...... MOS88 res ..........................T...........T...... MON86 res ..........................T...........T...... SVER82 res ..........................T...........T...... WS33 res ....................D.....V.................. LEN85 res ....................D.....VV................. WSN33 res ....................D....FV.................. LEN49 res ....................D.....VV..........T...... LEN6-83 res ....................D...S.VV..S.............. SWONT81 res ....................D.....VA..S.............. SW29-37 res ....................D.....VA..S.............. SWIA30 res ..........T.........D.....VA..S.............. SWWIS61 res ..........T.S.......D.....VA..S.............. SWIA88 res .................K..D.....VAV.S.............. AA60 sen ....................D.....VV..S.............H KOREA68 sen ....................D.....VV..S......F....... BANG79 sen ....................D.....VV..S.............. FW50 sen ....................D.....VV..S.............. MEM88 sen ....................D.....VV..S.............. USSR77 sen .............Q......D.....VV..S.............. PINALB79 sen ..........T..G.E.K.SD.....V...S.............. SWHK82 sen ..........T..G.E.K.SD.....V...S.............. SWNED85 sen ..........T..G....FSD.....V...S.............. FPVR34 sen ..........T..G.E....D.....I...S............N. MLRDNY78 sen ..........T..G.E.K.SD.....V...S.............. TYMN81 sen ..........T..G.E.K.SD.....V...S.............. TYMN80 sen ..........T..G.E.K.SD.....V...S.............. CKVIC85 sen ..........T..G.E.K.SD.....V...S.............. ProAnWin IS USEFUL IN: - protein structure-function and structure-activity investigations; - designing proteins and peptides with improved activity; - making multiple protein alignments and getting sense from it; - studying phenotype-genotype correlations; - preparation of protein 3D pictures with sites highlighted; - comparative protein sequence analysis. AVAILABILITY: ProAnWin is available (as self-extracted archive) from EBI software library: ftp://ftp.ebi.ac.uk/pub/software/dos/proanwin and, in Eastern Hemisphere, from NSC software library: ftp://ftp.bionet.nsc.ru/pub/biology/vector/proanwin.dem/paw$.exe The version is limited in number of analyzed sequences. INSTALLATION: The files required to run ProAnWin are distributed in the form of a single compressed file. Create a directory "PROANWIN" in your hard disk, for example, C. Copy the file to the directory, run the file from DOS prompt and answer Yes to all questions. To start the program run PROAWIN.EXE from windows. PROGRAM CONTENT: Directory: Main directory - program modules DATA - examples of data and output files; amino acid physico-chemical properties (>50); manual ALIGNS - 50 aligned protein family sequences PUBLICATIONS: 1. Eroshkin A.M., Zhilkin P.A., Fomin V.I. Algorithm and computer program PROANAL for analysis of relationship between structure and activity in a family of proteins or peptides. CABIOS, 1993, 9, 491-497. 2. Eroshkin A.M., Minenkova O.O., Fomin V.A., Ivanisenko V.A., Ilyichev A.A. Analysis of peptide fragment insertions into major coat protein of bacteriophages M13, f1 and fd. Relation of protein structural characteristics and viability of mutant phages. Molec. Biology (Russia), 1993, 27, 1345-1355. 3. Eroshkin A.M., Fomin V.I., Zhilkin P.A., Ivanisenko V.A., Kondrakhin Y.V. PROANAL version 2: multifunctional program for analysis of multiple protein sequence alignments and studying structure-activity relationships in protein families. CABIOS, 1995, 11, 39-44. 4. Morozov B.M., Ivanisenko V.A., Eroshkin A.M., Ugarova N.N. Analysis of relations between bioluminescence color and the structure of beetle luciferases: identification of the sites influencing bioluminescence color. Molec. Biology (Russia), in press. Comments, bug reports, suggestions for new features are welcome and should be sent by e-mail to: Alexey Eroshkin OTHER TOOLS AVAILABLE: ProAnalyst, Multifunctional analysis of protein sequences and structures (MS-DOS version of ProAnWin with additional functionality: searching motifs, physico-chemical plots, alphabetical and physico-chemical analysis of protein sequence variation, structure-activity determination profile, etc.): IUBio archive: ftp://iubio.bio.indiana.edu/molbio/ibmpc/panalys1 EMBL library: ftp://ftp.ebi.ac.uk/pub/software/dos/proanalyst NSC library: ftp://ftp.bionet.nsc.ru/pub/biology/vector/proanaly.dem/panalys$ ProMSED, Protein Multiple Sequences EDitor for MS Windows 3.x/95 ("a la" Word for Windows style + ClustalV + manual alignment + amino acid coloring + more): EMBL library: ftp://ftp.ebi.ac.uk/pub/software/dos/promsed NSC library: ftp://ftp.bionet.nsc.ru/pub/biology/vector/promsed.dem/promsed$ IUBio archive: ftp://iubio.bio.indiana.edu/molbio/ibmpc/promsed1 ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ Dr. Alexey Eroshkin Institute of Molecular Biology E.mail: eroshkin@vector.nsk.su State Research Center of Virology and Tel: +7 (3832) - 647774 Biotechnology "Vector" Fax: +7 (3832) - 328831 Koltsovo, Novosibirsk Region 633159 Russia ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ From owner-schistosoma@net.bio.net Thu Oct 03 23:00:00 1996 Path: biosci!AVA.BCC.ORST.EDU!baynec From: baynec@AVA.BCC.ORST.EDU (Christopher Bayne) Newsgroups: bionet.organisms.schistosoma Subject: Notice of positions. Date: 4 Oct 1996 16:13:56 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 16 Sender: daemon@net.bio.net Distribution: world Message-ID: <9610042314.AA29683@BCC.ORST.EDU> NNTP-Posting-Host: net.bio.net Subject: Notice of position. A Post-Doctoral position has just opened up at Oregon State University, to develop means to establish cell lines from schistosomes. Dr. David Barnes or Christopher Bayne want to hear from individuals with recent, appropriate Ph.D.s. Experience (evidenced by publications) with molecular techniques in a cell culture laboratory is essential; a parasitology background is merely desirable. The individual must be able to begin work in Oregon by January 1997. Send letter of application, resume (CV), and the names, addresses and phone numbers for 3 individuals qualified to comment of the applicant's qualifications to Christopher Bayne at the following address. Christopher J. Bayne, Ph.D., Professor of Zoology, Oregon State University, Corvallis, OR 97331-2914 TEL: 541-737-5352. FAX: 541-737-0501 e-mail: baynec@bcc.orst.edu From owner-schistosoma@net.bio.net Fri Oct 04 23:00:00 1996 Path: biosci!agate!howland.erols.net!feed1.news.erols.com!arclight.uoregon.edu!news-feed.inet.tele.dk!clio.trends.ca!bellglobal.com!news1.sympatico.ca!news From: Jacqueline Norris Daigneault Newsgroups: bionet.organisms.schistosoma Subject: schistosoma Date: Sat, 05 Oct 1996 14:01:42 -0700 Organization: Sympatico Lines: 4 Message-ID: <3256CCB6.506B@sympatico.ca> NNTP-Posting-Host: ppp34.qc.sympatico.ca Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 2.02E-SYMPA (Win16; I) I'm a university student studying anthropology and my subject is schistosoma, I need any information I can find on this malady and it's treatment and care etc. Any help that you can give would be grately appreciated. From owner-schistosoma@net.bio.net Mon Oct 07 23:00:00 1996 Path: biosci!agate!howland.erols.net!www.nntp.primenet.com!nntp.primenet.com!nntp.uio.no!nntp.zit.th-darmstadt.de!fu-berlin.de!cs.tu-berlin.de!uni-duisburg.de!news.rz.uni-duesseldorf.de!usenet From: Werner Kunz Newsgroups: bionet.organisms.schistosoma Subject: Re: schistosoma Date: Tue, 08 Oct 1996 14:58:29 -0700 Organization: Insitut für Genetik Lines: 30 Message-ID: <325ACE85.1E48@uni-duesseldorf.de> References: <3256CCB6.506B@sympatico.ca> NNTP-Posting-Host: 134.99.200.33 Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 2.0 (Win16; I) Jacqueline Norris Daigneault wrote: > > I'm a university student studying anthropology and my subject is > schistosoma, I need any information I can find on this malady and it's > treatment and care etc. Any help that you can give would be grately > appreciated. Dear Jacqueline Norris Daigneault: this is the most useful book for your information: Rollinson, D. and Simpson, A.J.G. The Biology of Schistosomes: From Genes to Latrines, London:Academic Press Ltd. 1987.pp. 1-472. ISBN: 0-12-593692-3 -- Prof. Dr. Werner Kunz Genetic Parasitology Institute for Genetics Heinrich-Heine-University Universitaetsstr. 1 D-40225 Duesseldorf Germany E-mail: Werner.Kunz@uni-duesseldorf.de Attention: New Tel.- and Fax-number: (49)211-81-12333 From owner-schistosoma@net.bio.net Sun Oct 13 23:00:00 1996 Path: biosci!CIENS.ULA.VE!larmatej From: larmatej@CIENS.ULA.VE (Eldimar Jose Larez Mata) Newsgroups: bionet.organisms.schistosoma Subject: (no subject) Date: 14 Oct 1996 14:21:48 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 1 Sender: daemon@net.bio.net Distribution: world Message-ID: <3262AFB7.794BDF32@ciens.ula.ve> NNTP-Posting-Host: net.bio.net subscribe schisto From owner-schistosoma@net.bio.net Sun Oct 13 23:00:00 1996 Path: biosci!agate!howland.erols.net!newsfeed.internetmci.com!news.ycc.yale.edu!news From: Dave Kahn Newsgroups: bionet.organisms.schistosoma Subject: Kichocho Date: Mon, 14 Oct 1996 18:04:37 -0700 Organization: Yale University Lines: 6 Message-ID: <3262E325.5C49@biomed.med.yale.edu> NNTP-Posting-Host: 130.132.98.166 Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Mailer: Mozilla 2.0 (Win16; I) Does anyone know where I can get a copy of this video? I am working on a project for a topics course in international health.... thanks, jinky angjc@biomed.med.yale.edu From owner-schistosoma@net.bio.net Sun Oct 13 23:00:00 1996 Path: biosci!ASMS3.DSC.K12.AR.US!jhunter From: jhunter@ASMS3.DSC.K12.AR.US ("Jeffrey J. Hunter") Newsgroups: bionet.organisms.schistosoma Subject: Schistosomes Date: 14 Oct 1996 14:28:24 -0700 Organization: Arkansas School for Math & Science Lines: 18 Sender: daemon@net.bio.net Distribution: world Message-ID: <1377C1C3257@ASMS3.DSC.K12.AR.US> NNTP-Posting-Host: net.bio.net To whom it may concern: Hello! My name is Jeffrey J. Hunter. I am a student at the Arkansas School for Mathematics and Sciences in Hot Springs, Arkansas, USA. I hope to be able to do research on Schistosomes for use in the International Science Fair. I would appreciate any help that you might be able to give me. Once again, thanks. Sincerely, Jeffrey J. Hunter Arkansas School for Mathematics and Sciences 100 Whittington Ave. Hot Springs, AR 71901 USA E-Mail: JHUNTER@ASMS3.DSC.K12.AR.US From owner-schistosoma@net.bio.net Tue Oct 15 23:00:00 1996 Path: biosci!south-01.novell.leeds.ac.uk!bgyakj From: bgyakj@south-01.novell.leeds.ac.uk ("A.K. JONES") Newsgroups: bionet.organisms.schistosoma Subject: Data banks Date: 16 Oct 1996 09:24:38 -0700 Organization: University of Leeds Lines: 8 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net To whoever this may concen I am starting a postgraduate degree at the University of Leeds, and I will be studying various aspects of the schistosome tegument. I was wondering whether it would be possible for you to send me some web sites concerning schistosome gene data banks. Thanks very much Andrew Jones From owner-schistosoma@net.bio.net Fri Oct 18 23:00:00 1996 Path: biosci!internet!biosci!not-for-mail From: biohelp (BIOSCI Administrator) Newsgroups: bionet.organisms.schistosoma Subject: BIOSCI/bionet miniFAQ & Fundraiser Date: 19 Oct 1996 02:00:44 -0700 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 239 Sender: daemon@net.bio.net Distribution: world Message-ID: <199610190900.CAA12050@net.bio.net> NNTP-Posting-Host: net.bio.net (LAST REVISION: 30-JUL-95) This BIOSCI "miniFAQ" is designed to answer the questions that come up the *most frequently*. The main BIOSCI FAQ (Frequently Asked Questions) is accessible on the World Wide Web at URL http://www.bio.net/. If you can not find an answer to your question in this or other documentation, the BIOSCI technical support staff answers e-mail queries sent to biosci-help@net.bio.net We can only answer questions about the use of the newsgroups and mailing lists. We unfortunately do not have the staff to do Internet information searches or answer scientific questions. Please post those to the appropriate BIOSCI/bionet newsgroups. Contents: -------- 0) BIOSCI NEEDS YOUR SUPPORT!! 1) Using the WWW to access the BIOSCI/bionet newsgroups. 2) What to do about "spams," i.e., junk mail, ads, etc. 3) Examples of subscribing and unsubscribing to the mailing lists. 4) The BIOSCI user address and research interest directory. 0) BIOSCI NEEDS YOUR SUPPORT!! ------------------------------ BIOSCI's government funding has been expended, and we are now operating solely from advertising revenue that we have raised from our Web site at http://www.bio.net/. We need just a few minutes of your time to help us serve you. You can do two important things which will take very little time for you individually and will immensely help us continue to help you. First, please use our WWW system at http://www.bio.net/ to access the archives. You can post or reply to messages via your Web browser as described in item #1 below. Your usage helps attract sponsors. If you contact any of our sponsors, please be sure to thank them for supporting BIOSCI. It is critical for them to get this feedback if they are to continue their sponsorship for the long term. Second, if you work for a company or organization that provides products or services of interest to the biology community, please pass this message on to your marketing or marketing communications department or other appropriate group. Please ask them to help support BIOSCI by sponsoring our Web site and explain the uses and benefits of the system to the biology community. If they are interested, they can then contact us for further information at our tech support address, biosci-help@net.bio.net. 1) Using the WWW to access the BIOSCI/bionet newsgroups. -------------------------------------------------------- As of 10 December 1995, all BIOSCI/bionet full newsgroups are accessible through the World Wide Web (WWW) at URL http://www.bio.net. One can read and reply publicly or privately to both recent postings and archived messages through one's Web browser if it is configured properly to send e-mail. Each newsgroup is equipped with its own WAIS index. The main BIOSCI home page also has access to the BIO-JOURNALS Table of Contents database WAIS index and the BIOSCI user address database described in another item further below. 2) What to do about "spams," i.e., junk mail, ads, etc. ------------------------------------------------------- BIOSCI is a set of parallel USENET newsgroups (the "bionet" groups), mailing lists, and a hypermail archive at URL http://www.bio.net/. The same postings are distributed on all media (except for a small number of mailing-list-only groups at net.bio.net). Unfortunately it is becoming a despicable practice on the Internet (by a few people out to make a fast buck) to do automated mass postings to thousands of newsgroups and mailing lists. These attempts to grab free advertising are refered to as "spams" in the usual, somewhat boneheaded, net terminology. USENET is more susceptible to this practice, and many spams originate on the USENET groups and then are passed on to the mailing lists. However, spammers also get lists of mailing addresses and hit these too, so neither medium is immune. What should you do personally if you get junk mail? --------------------------------------------------- Just delete it and move on without reading it further. Filing a protest is becoming increasingly useless because spammers are often disguising the addresses where the messages are sent from. Unless you really understand Internet mail systems, your attempt at protest by sending replies to the message will often end up being sent to the address of an innocent person that the spammer is victimizing. What can BIOSCI/bionet do to protect its newsgroups? ---------------------------------------------------- The only solution currently available is to moderate the newsgroup. If this newsgroup is already moderated, then you are in good shape. Moderation protects the USENET distribution from about 95% of the spams that are being sent to date and protects the mailing lists completely. Moderation means, however, that someone has to take the time to review each message before it goes out. We have set up software here that simply allows the moderator to forward to an address at net.bio.net messages that (s)he wishes to have distributed. This takes no more time than that needed to read the message and pass it on, say about 1 min. per message. Most newsgroups currently have a discussion leader who is responsible for their newsgroup. The discussions leaders and their e-mail addresses are listed in the BIOSCI Information Sheet which is available on the Web at http://www.bio.net/. If a newsgroup is being hit with too many junk postings, please contact the discussion leader for that group and see if there is interest in moderating the group. Please do not assume that by simply posting a complaint to the newsgroup itself, anyone on the BIOSCI staff will act on your complaint. With close to 100 newsgroups to run, the BIOSCI staff has to rely on the discussion leaders of each newsgroup to report problems directly to us at biosci-help@net.bio.net. We will moderate any of our newsgroups if the discussion leader tells us that the readership of the group wishes to do so and if a moderator is willing to do the work. For most BIOSCI/bionet groups, this entails only a few minutes of work each day. Moderating a newsgroup will resolve probably 95% of the junk postings on the USENET distribution. Unfortunately there are easy ways for determined spammers to override the moderation mechanism on USENET, but we can protect our e-mail subscribers from unwanted postings if the newsgroup is moderated. You can also access our newsgroups over the WWW at URL http://www.bio.net. While this Web interface will not stop spammers from trying to post to the groups, this will give you yet another way, besides using USENET news, to keep the junk out of your personal mail files. For those of you with local USENET news systems, the Web interface will also give you faster access to new newsgroups and recent postings. 3) Examples of subscribing and unsubscribing to the mailing lists. ------------------------------------------------------------------ PLEASE NOTE: The BIOSCI management does NOT act on subscription/unsubscription requests that are posted improperly to the newsgroups and mailing lists. People who do this only bother everyone on the lists to no avail. Please be sure to follow the proper procedures below. Gory details are in the BIOSCI Information sheets on the Web at http://www.bio.net. Below we give an example utilizing the METHODS-AND-REAGENTS list at both of our two BIOSCI sites: Users in the Americas and Pacific Rim countries who use the BIOSCI ------------------------------------------------------------------ node at computer net.bio.net: ---------------------------- A) Determine the "listname" which is the <=8 character mail address ^^^^^^^^^^^^^ for the group. These can be found in the BIOSCI Info. Sheet. For the METHODS-AND-REAGENTS group the mailing address is methods@net.bio.net. The listname is the portion of the address to the left of the @ sign, i.e., "methods". The listname is used with the "subscribe" and "unsubscribe" commands illustrated below. B) Mail all commands in the body of a mail message addressed to biosci-server@net.bio.net. Do NOT send commands to the newsgroup posting addresses! Leave the Subject: line blank, any text on it will be ignored. C) In the body of your message put one or more of the following commands with an "end" command on the last line, e.g., subscribe methods unsubscribe methods end Do NOT put your e-mail address or other text on these lines. The server only allows you to cancel your subscription if the address on your mail header matches the address on our mailing list. Please ask for help at biosci-help@net.bio.net if your address has changed, e.g., if you know you are on the list but the server tells you that you are not a member. Users in Europe, Africa, and Central Asia who use the BIOSCI node at -------------------------------------------------------------------- computer daresbury.ac.uk (also known as dl.ac.uk): ------------------------------------------------- To subscribe and unsubscribe to/from the BIOSCI lists, you need to specify the full USENET newsgroup name with "bionet-news." prepended. The USENET newsgroup names are listed in the BIOSCI Information sheet on the Web at http://www.bio.net/. For the METHODS-AND-REAGENTS list the USENET newsgroup name is bionet.molbio.methds-reagnts, thus the appropriate commands are sub bionet-news.bionet.molbio.methds-reagnts unsub bionet-news.bionet.molbio.methds-reagnts These commands are included in a message addressed to mxt@dl.ac.uk, NOT to the newsgroup mailing addresses. As usual, include the text in the body of the message as text on the Subject: line is ignored. To unsubscribe from all the lists at the UK node, use unsub bionet-news Please note that if the address in the list is different than the one in your mail message header, you will not be able to unsubscribe by this method. If you have problems, please mail biosci@daresbury.ac.uk. 4) The BIOSCI user address and research interest directory. ----------------------------------------------------------- Please take this opportunity to add your name, address, and research interest information to the BIOSCI User Address Database if you have not already done so. You can fill out the address form directly through our Web page at URL http://www.bio.net/adrform.html. The address database is reindexed nightly for WWW access (the URL is http://www.bio.net/). If you are not directly on the Internet but can reach it by e-mail, please use our waismail server to access the user directory. waismail use is described above. You can also request a user address form by e-mail from biosci-help@net.bio.net. Please check your database entry from time-to-time to see if your address information is still up-to-date. Because of our limited personnel resources, we ask that you resubmit a *complete* form to revise your entry; we only replace complete entries and do not have resources to edit old forms. Sincerely, Dave Kristofferson BIOSCI/bionet Manager biosci-help@net.bio.net From owner-schistosoma@net.bio.net Sun Oct 27 22:00:00 1996 Path: biosci!NCBI.NLM.NIH.GOV!francis From: francis@NCBI.NLM.NIH.GOV Newsgroups: bionet.organisms.schistosoma Subject: Re: Data banks Date: 27 Oct 1996 22:23:05 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 55 Sender: daemon@net.bio.net Distribution: world Message-ID: <199610280622.BAA02709@borduas.nlm.nih.gov> NNTP-Posting-Host: net.bio.net A.K. JONES (bgyakj@south-01.novell.leeds.ac.uk) wrote: > I am starting a postgraduate degree at the University of Leeds, > and I will be studying various aspects of the schistosome tegument. I > was wondering whether it would be possible for you to send me some > web sites concerning schistosome gene data banks. Sorry I took so long to reply, but I don't visit this newsgroup frequently! If you look at our taxonomic browser: http://www3.ncbi.nlm.nih.gov/Taxonomy/tax.html You will see that we have in GenBank almost 2000 DNA sequences and 370 protein sequences represented in some 12 Schistosoma species. With this browser you can retrive these records, or refine your query with Entrez. (do not that what what represent in this 'tree' is what is known at the DNA sequence level (ie we have sequences for the organism, we then put it in our database, and does not represent all we (you) know about Schistosoma. Schistosoma [1997 / 370] Schistosoma bovis [5 / 2] Schistosoma curassoni [1 / 0] Schistosoma haematobium [18 / 12] Schistosoma intercalatum [7 / 1] Schistosoma japonicum (blood fluke) [56 / 62] Schistosoma malayensis [1 / 0] Schistosoma mansoni (blood fluke) [1893 / 291] Schistosoma margrebowiei [2 / 0] Schistosoma mattheei [3 / 0] Schistosoma mekongi [5 / 2] Schistosoma rodhaini [3 / 0] Schistosoma spindale [3 / 0] If you have any question about this, please feel free to send a message to our servive desk (info@ncbi.nlm.nih.gov) cheers, f. -- | B.F. Francis Ouellette | GenBank | | francis@ncbi.nlm.nih.gov From owner-schistosoma@net.bio.net Sun Oct 27 22:00:00 1996 Path: biosci!AIXTERM1.URZ.UNI-HEIDELBERG.DE!jschmitt From: jschmitt@AIXTERM1.URZ.UNI-HEIDELBERG.DE (Juergen Schmitt) Newsgroups: bionet.organisms.schistosoma Subject: e-mail address of ANDRE CAPRON Date: 28 Oct 1996 06:59:27 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 6 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Who ever knows??!! I`d like to contact Andre Capron to get some special information about PKC in Schisto and Biomphalaria. Does anybody know his e-mail address? Greetings and good luck with your work Melanie From owner-schistosoma@net.bio.net Mon Oct 28 22:00:00 1996 Path: biosci!MAILBOX.UQ.OZ.AU!p.prociv From: p.prociv@MAILBOX.UQ.OZ.AU Newsgroups: bionet.organisms.schistosoma Subject: (none) Date: 28 Oct 1996 19:00:29 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 10 Sender: daemon@net.bio.net Distribution: world Message-ID: <199610290259.MAA01688@bunyip.cc.uq.oz.au> NNTP-Posting-Host: net.bio.net subscribe Paul Prociv, Assoc Prof, Dept Parasitology, and Deputy Dean, Faculty of Medicine, The University of Qld, Qld. 4072, AUSTRALIA Tel: +61 7 336 53306 (home: +61 7 387 00067); Fax: +61 7 336 51588 "There are two kinds of tragedy in life. The first is when you don't get what you want. The other is when you do". Oscar Wilde From owner-schistosoma@net.bio.net Mon Oct 28 22:00:00 1996 Path: biosci!CGL.UCSF.EDU!jmck From: jmck@CGL.UCSF.EDU (James McKerrow) Newsgroups: bionet.organisms.schistosoma Subject: gordon conference Date: 29 Oct 1996 14:36:02 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 23 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Hello schisto folks, I wanted to alert everybody to the upcoming Gordon Conference on Parasitism which will be in Newport,RI,USA July6-11,1997. There will be lots of interesting worm talks including bloodfeeding, immunopathogenesis, and parallels form the world of plant nematodes. Check out our web site http://mdi.ucsf.edu/gordon_conference_parasite.html Apply early because it is filling fast. Jim McKerrow JAMES H.McKERROW Phd,MD Professor of Pathology and Pharmaceutical Chemistry Director, Tropical Disease Rearch Unit University of California, San Francisco VAMC 113B 4150 Clement St. San Francisco, CA 94121 Ph 415.476.2940 Fax 415.502.2611 From owner-schistosoma@net.bio.net Tue Oct 29 22:00:00 1996 Path: biosci!qimr.edu.au!sharonD From: sharonD@qimr.edu.au (Sharon Day) Newsgroups: bionet.organisms.schistosoma Subject: subscribe Date: 29 Oct 1996 16:16:01 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 9 Sender: daemon@net.bio.net Distribution: world Message-ID: NNTP-Posting-Host: net.bio.net Sharon Day Molecular Parasitology Unit Queensland Institute of Medical Research Brisbane, Queensland Australia (ph) 61-7-33620414 (fax) 61-7-33620104 From owner-schistosoma@net.bio.net Tue Oct 29 22:00:00 1996 Path: biosci!CIS.CO.ZA!orion From: orion@CIS.CO.ZA (david durrheim) Newsgroups: bionet.organisms.schistosoma Subject: (none) Date: 30 Oct 1996 04:58:25 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 2 Sender: daemon@net.bio.net Distribution: world Message-ID: <01BBC672.6D047280@net-49-236.cis.co.za> NNTP-Posting-Host: net.bio.net unsubscribe From owner-schistosoma@net.bio.net Thu Oct 31 22:00:00 1996 Path: biosci!daresbury!not-for-mail From: Dave Johnston Newsgroups: bionet.organisms.schistosoma Subject: Schisto Genome Data Analysis - an offer of assistance/collaboration. Date: 1 Nov 1996 10:15:57 -0000 Lines: 80 Sender: lpddist@mserv1.dl.ac.uk Distribution: bionet Message-ID: <55cikt$7nk@mserv1.dl.ac.uk> MIME-Version: 1.0 Original-To: schisto@dl.ac.uk Dear All, 3 pieces of news: (1) I have been contacted by Saira Mian of the Lawrence Berkely National Laboratoty in the USA (saira@cse.ucsc.edu) with the offer of assistance in analysis of schisto genome data and of acting as a contact point for people with data analysis problems, queries etc. she writes: "My research interests include genome informatics, the structure, function and evolution of macromolecules and processes that subvert the linear reading of genomic sequences..... see http://www.cse.ucsc.edu/research, in particular the descriptions of hidden Markov models for modelling proteins and stochastic context free grammars of RNA. I would be interested in becoming involved in analysis of Schistosoma DNA...... Apart from the intrinsic scientific interest, it's one way of contributing to efforts aimed at understanding an organism that has such devasting consequences for health in less-well developed countries.........Looking at the figures for EST hits, it seems as if there is plenty of work to do........ I would be happy to act a general resource/point of contact for anyone in the Schisto Network if they have questions or need help with analysis of their data from a theoretical and/or computational perspective. My interests lie both in developing new methods and applying them to problems of specific "biological" interest. I have a number of fruitful collaborations with researchers who are primarily experimentalists so I'm familiar with working with individuals having little or no background in this area. If there are others who end up expressing interest in analysing the data from the Schisto project, I would have no objections to collaborating with them. As you say, there is no lack of data to go round...... If any projects (developed from the EST data) feel their chances of being funded would be improved were there a computational component to the proposal and would thus benefit from including me, let me know. I look forward to hearing from you soon. saira" Saira is keen to receive ideas as to the sorts of analyses you wish to see done on your data, your priorities etc. so please feel free to contact her with your suggestions. This is a very generous offer and one which, I am sure, will bring significant benefits to the initiative so please take advantage of it and talk with her. ------------------------------------------------------------------ (2) I am shortly to begin updating the schisto EST records in DBEST to reflect the agreed new clone/EST nomenclature. Your original clone and sequence IDs will be preserved as comment lines in the records. Submitters are therfore likely to receive mail from NCBI, informing them of the proposed changes and asking for their approval for the changes (since I didn't submit them, it is their policy to check with the original submitters). We are withholding release of version 1 of SchistoDB until the records have been updated. I will keep you informed of progress. ------------------------------------------------------------- (3) Hopefully, people will hear from WHO in the next week or so whether their applications have been successful or not (but its no good writing to Mette or I because we don't know anything). With best wishes to everyone, David. DAJ David A Johnston Researcher, Biomedical Parasitology, Dept. of Zoology, The Natural History Museum, Cromwell Road, London SW7 5BD. tel: 0171 9389297 (from outside UK: 44 171 9389297) fax: 0171 9388754 (from outside UK: 44 171 9388754) eMail daj@nhm.ac.uk From owner-schistosoma@net.bio.net Thu Oct 31 22:00:00 1996 Path: biosci!med.uoeh-u.ac.jp!shimada From: shimada@med.uoeh-u.ac.jp (Masaaki Shimada) Newsgroups: bionet.organisms.schistosoma Subject: Homepage for the IXth International Congress of Parasitology Date: 1 Nov 1996 04:07:33 -0800 Organization: BIOSCI International Newsgroups for Molecular Biology Lines: 27 Sender: daemon@net.bio.net Distribution: world Message-ID: <199611011207.VAA29300@wombat.med.uoeh-u.ac.jp> NNTP-Posting-Host: net.bio.net Dear Colleagues: First announcement of the IXth International Congress of Parasitology is now available at: http://icopa.med.uoeh-u.ac.jp/~welcome I hope you will visit the web site and register for the second circular. For the XIVth International Congress for Tropical Medicine and Malaria, which will be held in Nagasaki this month, you can obtain useful information at: http://ictm.med.uoeh-u.ac.jp/ Have a nice weekend! *********************************************************** $BEhED2mZ|!!;:6H0e2JBg3X!!4s@8Cn3X!&G.BS0e3X(J This line contains Japanese Masaaki Shimada, M.D. Department of Parasitology and Tropical Public Health University of Occupational and Environmental Health, Japan tel +81-93-691-7245 / fax +81-93-602-4488 e-mail: shimada@med.uoeh-u.ac.jp ************************************************************