Error when inputting peptide sequences

Simon Whitfield simon at TITUS.U-STRASBG.FR
Wed Jun 11 08:38:38 EST 1997


Hello,

I'm trying to read protein sequences into AceDB 4.3 via ace files. I
_think_ I have the syntax right for the peptide data, but I get an error
message. For example, the entry


Protein SW:Q01705
Title "NTC1_MOUSE..."
DNA_homol MMNOTCHA "BLASTX" 14408 1 2531 79 7671
Database SWISSPROT Q01705

Peptide SW:Q01705
MPRLLTPLLCLTLLPARAARGLRCSQPSGTCLNGGRCEVASGTEACVASGSFVGQRCQDP
NPCLSTRCKNAGTCYVVDHGGIVDYACSCPLGFSGPLCLTPLDKPCLANPCRNGGTCDLL
TLTEYKCRCSPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVN



gives the error message 

"Type of SW:Q01705 does not check in B object "SW:Q01705" "

Can anyone explain to me what is going on?

Thanks, 
Simon Whitfield

simon at igbmc.u-strasbg.fr

-- 

  IGBMC, BP 163, 67404 Illkirch Cedex, C.U. de Strasbourg, France.
  Phone (+33) 03 88 65 34 33              Fax (+33) 03 88 65 32 46




More information about the Acedb mailing list