Hi there,
Somebody must have asked this question before. I am sorry I have to ask this
because Surprisingly I can't find any document describing how to load protein
sequence into AceDB. Isn't the usage of Peptide the same as DNA? Please help!
Qunfeng
ps.what's wrong with the following simple ace file?
When I tried to load this file, xace hangs at
Item: 2 Q08062
Line: 4 (49%)
Pased: 2
OK: 2
Errors: 0
with NO error message. Why?
------------------------------------------------------
Protein : Q08062
Title "Malate dehydrogenase, cytoplasmic."
Peptide Q08062 40
Peptide : Q08062
MATQTAVTATTVPQGSPSVTGSASQGGILNSARQFFSLAAPKVEKDKEFSFRFLTSP
LRSKPAATVNADNFYMYACGSINMP
------------------------------------------------------
If I replaced the above seq with
makepmrvlvtgaagqigyalvpmiargvmlgadqpvilhmldippaaealngvkmelvd
then I got error message:
ERROR - array parse error, near line 0 while parsing "Peptide : Q08062", error
was: peptideParse error at line 8 in Q08062 : bad char m(0x6d)
Please help!
Qunfeng