will the real psbT please stand up.

Stephen M. Gomez gumby at ALUMNI.CALTECH.EDU
Wed Oct 16 14:33:56 EST 1996


I'm kinda confused by the nomenclature for psbT.
It seems to me that this name has been used for a nuclear gene and a 
chloroplast gene.  Try as I might I can't see how they can be the same, 
or even be a gene transfer from the chloroplast to the nucleus.

ATPSIISBT X98078 518bp RNA PLN 06-JUN-1996
A.thaliana mRNA for subunit T of photosystem II.
photosynthesis; photosystem II; psbT gene; subunit T; PsbT.

Nuclear encoded "psbT":

Arabidopsis thaliana 1>			
masmtmtatffp--avakvpsatggrrlsvvra---stsdntpslevkeqssttmrrdlmftaaaaavcslakvam 
aeeeepkrgteagkkkyaqvcvtmrtakicry
Arabidopsis thaliana 2>					
masmtmtatffp--avakvpsatggrrlsvvra---stsdntpslevkeqssttmrrdlmftaagaavcslakvam
aeeeepkrgteagkkkyaqvcvtmptakicry
Gossypium hirsutum>			
masitmttsflsttnltkgspritqrrlvvanaakgaqvesvqmsgerktegnngrremmfaaaaaaicsvagvat
a---epkrgsaeakkayapvcvtmptaricrn
Spinacia oleracea (pept)>
----------------------------------------------------------------------------
---eepkrgtpeakkkyapvxvtmpsarixyk

Chloroplast encoded "psbT":

Spinacia oleracea>
mealvytfllvstlgiiffaiffreppkis---tkk
Oenothera argillicola>
mealvytfllvstlgiiffaiffreppkiq---tkrrndf
Pisum sativum>
mealvytfllvsk-elvffaiffreppkvptkntk
Nicotiana tabacum>
mealvytfllvstlgiiffaiffreppkvp---tkkn
Secale cereale>
mealvytfllvstlgiiffaiffreppkvpptptkrik
Zea mays>
mealvytfllvstlgiiffaiffreppkvp---tkk
Oryza sativa>
mealvytfllvstlgiiffaiffreppkvp---tkkvk
Pinus thunbergiana>
mealvytfllvstlgiiffaiffreppklp---tkggk
Marchantia polymorpha>
mealvytfllvgtlgiiffaiffreppkvp---skgkk
Chlamydomonas reinhardtii>
mealvytfllvgtlgiiffsiffrdpprm----ik
Euglena gracilis>
mealvytflligtlgviffaiffrespri----nk
Cyanophora paradoxa>
mealvytfllvttlgilffsiifrdppri----nq
Odontella sinensis>
mealvytflligtlmviffavffretpri---lrk
Porphyra purpurea>
mealvyvflltgtlmviffaiffreppri----ak

Please forward this to anyone you know who might work w/ this 
gene/protein.  I'd appreciate any replies be CC'd to my email since I 
don't read this newsgroup often.

Thanx.
Confused in LA

Stephen Gomez
Dept. Mol. Cell & Dev. Bio.
UCLA
gumby at alumni.caltech.edu




More information about the Arab-gen mailing list