GL2 correction

M. David Marks dmarks at BIOSCI.CBS.UMN.EDU
Thu Oct 24 18:20:24 EST 1996


To anyone working with the Arabidopsis GL2 gene sequence reported in Rerie et 
al., 1994. Genes and Development 8:1388-1399. There are two sequencing errors in
the last exon of the sequence listed under the accession number L32873. The 
reported coding sequence for the end of the GL2 protein is "VVVYR
SRRYKHDTAGARGT"
the real sequence for this region is "VVVY
APVDINTTQLVLAGHDPSNIQILPSGFSIIPDGVESRPLVITST
QDDRNSQGGSLLTLALQTLINPSPAAKLNMESVESVTNLVSVTLHNIKRSLQIEDC"

This change is due to two base errors in the region encoding the last 
exon.

The "C" at position 7261 should be deleted. Thus "ataccgct" should be 
"atacgct".

There should be an exta "C" at position 7331. Thus "tccctct" should be 
"tcccctct".

The result of these changes is that the last exon ends at position 7561
instead of 7307.

M. David Marks 







More information about the Arab-gen mailing list