transmembrane prediction routines

Nicolas Le Novere nl223 at cus.cam.ac.uk
Wed Jul 5 08:05:19 EST 2000


Chris LaRosa wrote:
 
> Actually we think not, but I assumed that I would get a report
> specifically documenting this finding.    However as the report shows
> the
> PhD htm lines are absent...

I just made a request with a piece of protein without TM and I got
the right answer:

--- PhdTopology REFINEMENT AND TOPOLOGY PREDICTION
                 
....,....1....,....2....,....3....,....4....,....5....,....6
         AA     
|LIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNA|
         PHD htm
|                                                            |
 detail:
         prH htm
|000000000000000000000000000000000000000000000000000000000000|
         prL htm
|999999999999999999999999999999999999999999999999999999999999|
 subset: SUB htm
|............................................................|
                 
....,....7....,....8....,....9....,....10...,....11...,....12
         AA     
|DGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKV|
         PHD htm
|                                                            |
 detail:
         prH htm
|000000000000000000000000000000000000000000000000000000000000|
         prL htm
|999999999999999999999999999999999999999999999999999999999999|
 subset: SUB htm
|............................................................|
                 
....,....13...,....14...,....15...,....16...,....17...,....18
         AA     
|SISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVV|
         PHD htm
|                                                            |
 detail:
         prH htm
|000000000000000000000000000000000000000000000000000000000000|
         prL htm
|999999999999999999999999999999999999999999999999999999999999|
 subset: SUB htm
|............................................................|
---
--- PhdTopology REFINEMENT AND TOPOLOGY PREDICTION END







More information about the Bio-soft mailing list