ProtComp - Version 3: (Animal/Fungi - Plants) Identification of sub-cellular localization
webmaster
webmaster at softberry.com
Wed Nov 29 07:36:09 EST 2000
ProtComp - Version 3: Program for Identification of sub-cellular localization
of Eukaryotic proteins: Animal/Fungi - Plants
ProtComp is available for public usage at: http://www.softberry.com/
http://www.softberry.com/protein.html
ProtComp: Current, third release of ProtComp includes separately
trained recognizers for Animal/Fungi and Plant proteins.
This separation is improving the recognition accuracy, which is
for major compartments (such as plasma membrane, nuclear,
extracellular) achives 70-90% level.
The program is based on complex neural-network recognizers, which identify
probability of the subcellular localization in nucleus, plasma membrane,
extracellular, cytoplasmic, mitochondrial, chloroplast, endoplasmic
reticulum, peroxisomal, lysosomal or Golgi compartments.
Example of Output results:
Presents scores for different networks and the final conclusion.
******************************************
Name: Q9Y6H8
First three lines of sequence:
MGDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEDVWGDEQSDFTCNTQQPGCENVCYDRAFPISHI
RFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAGALLRTYV
FNIIFKTLFEVGFIAGQYFLYGFELKPLYRCDRWPCPNTVDCFISRPTEKTIFIIFMLAVACASLLLNMLEIYHL
protcompan Tue Nov 28 22:23:17 EST 2000
Nuclear: Score 0.717
Plasma membrane: Score 1.590
Extracellular: Score 0.847
Cytoplasmic: Score 0.675
Mitochondrial: Score 0.713
Endoplasmic
reticulum: Score 0.805
Peroxisomal: Score 0.665
Lysosomal: Score 0.371
Golgi: Score 0.320
Predicted protein localization: Plasma membrane
---
More information about the Bio-soft
mailing list