ProtComp - Version 2: Program for Identification of sub-cellular localization
webmaster
webmaster at mail.softberry.com
Mon Oct 23 17:08:06 EST 2000
ProtComp - Version 2: Program for Identification of sub-cellular localization of
Eukaryotic proteins
ProtComp: Current, second release ProtComp includes basic scheme of
localization prediction. Third version, which will include additional
signals and compartments, is scheduled for release by the end of the year.
The program is based on complex neural-network recognizers, which identify
probability of the subcellular localization in nucleus, plasma membrane,
extracellular, cytoplasmic, mitochondrial, chloroplast, endoplasmic
reticulum, peroxisomal, lysosomal or Golgi compartments.
Accuracy of prediction tested on known proteins from TREMBL database:
Compartment Number tested % of true predictions
Nuclear 154 87.0
Plasma Membrane 80 90.0
Extracellular 74 64.9
Cytoplasmic 23 56.5
Mitochondrial 8 87.5
Chloroplast 17 64.7
Endoplasmic reticulum 19 63.1
Peroxisomal 6 50.0
Lysosomal 5 60.0
Golgi 11 81.8
--------------------------------------------------------------------------------
Total 397 70.5
Output results:
Presents scores for different networks and final conclusion in Weighted Score.
******************************************
Name: >Q9Y6H8_
First three lines of sequence:
MGDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEDVWGDEQSDFTCNTQQPGCENVCYDRAFPISHI
RFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAGALLRTYV
FNIIFKTLFEVGFIAGQYFLYGFELKPLYRCDRWPCPNTVDCFISRPTEKTIFIIFMLAVACASLLLNMLEIYHL
protcomp Mon Oct 23 17:09:33 EDT 2000
ProtComp Version 2, Softberry Inc., 2000
==============================================
Nuclear: Score 0.650
Plasma membrane: Score 1.391
Extracellular: Score 1.094
Cytoplasmic: Score 0.597
Mitochondrial: Score 0.647
Chloroplast: Score 0.606
Endoplasmic
reticulum: Score 0.692
Peroxisomal: Score 1.197
Lysosomal: Score -0.065
Golgi: Score 0.155
Predicted protein localization: Plasma membrane
---
More information about the Bio-soft
mailing list