New Drosophila specific gene-finding HMM based program FGENESH
Victor Solovyev
solovyev at sanger.ac.uk
Tue Mar 16 12:15:27 EST 1999
We installed New Drosophila specific gene-finding HMM based program FGENESH
for multiple gene prediction in genomic DNA
It is available at http://genomic.sanger.ac.uk/ of our
Computational Genomic Group WEB server
(http://genomic.sanger.ac.uk/gf/gf.html)
For analysis of Drosophila DNA FGENES or FGENESH versions
for human DNA can be used, however Drosophila
specific version has better exact exon prediction accuracy.
Accuracy of the program was estimated on a set of 500 sequences
containing one gene each (simple test)
It is about 94% at the nucleotide level and
74% of exons can be predicted exactly
TO USE Drosophila specific version click Drosophila button + fgenesh button
TO USE Human specific version click Human button + fgenesh button
Past your sequence to the window or load your file with sequence in FASTA
fromat
Example of output of the program:
FGENESH 1.0 Prediction of potential genes in Drosophila genomic DNA
Time: Tue Mar 16 15:11:34 1999.
Seq name: AB003910 4755 bp DNA INV
Length of sequence: 4755 GC content: 44 Zone: 1
Number of predicted genes 1 in +chain 1 in -chain 0
Number of predicted exons 2 in +chain 2 in -chain 0
Positions of predicted genes and exons:
G Str Feature Start End Score ORF Len
1 + TSS 2679 -6.30
1 + 1 CDSf 2753 - 3677 227.30 2753 - 3676 924
1 + 2 CDSl 3739 - 3944 41.75 3741 - 3944 204
1 + PolA 4312 1.05
Predicted protein(s):
>FGENESH 1 2 exon (s) 2753 - 3944 376 aa, chain +
MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKS
YELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVL
SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
QEYDESGPGIVHRKCF
--
Victor Solovyev
The Sanger Centre, Hinxton, Cambridge CB10 1SA, UK
Email: solovyev at sanger.ac.uk http://genomic.sanger.ac.uk
Phone: 44-1223-494799 FAX: 44-1223-494919
More information about the Bio-www
mailing list