ProtComp - Program for Identification of sub-cellular localization
webmaster
webmaster at mail.softberry.com
Fri Oct 13 03:58:31 EST 2000
A new program ProtComp - Program for Identification of sub-cellular localization of
Eukaryotic proteins
The program is based on complex neural-network recognizers, which identify probability of
the subcellular localization in nucleus, plasma membrane, extracellular, cytoplasmic,
mitochondrial, chloroplast, endoplasmic reticulum, peroxisomal, lysosomal or Golgi
compartments.
Program is installed for public use at http://www.softberry.com/pss/pss.html
ProtComp: Current, first release ProtComp includes basic scheme of localization
prediction. Second version, which will include additional signals and characteristics of
protein compartments, is scheduled for release by the end of the year.
Accuracy of prediction tested on known proteins from TREMBL database:
Compartment
Compartment Number tested % of true predictions
Nuclear 154 80.5
Plasma Membrane 80 85
Extracellular 74 58.1
Cytoplasmic 23 56.5
Mitochondrial 8 87.5
Chloroplast 17 47
Endoplasmic
reticulum 19 63.13
Peroxisomal 6 50
Lysosomal 5 40
Golgi 11 63.16
Total: 397 63.13
Input data: Paste plain sequence to the window or upload file in Fasta format.
Output results:
Presents scores for different networks and final conclusion in Weighted Score.
Statistics section presents results of analysis of several sequences uploaded in
Fasta format.
******************************************
Seq name: Q16845, Sequence:
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPL
PGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRRRNAEYNPKRFA
AVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDV
KFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYP
ILKGFRKTT
Nuclear: Score1= 0.546 Score2= 0.690 Weighted Score= 1.236
Plasma
membrane: Score1= 0.306 Score2= 0.000 Weighted Score= 0.280
Extracellular: Score1= 0.360 Score2= 0.690 Weighted Score= 1.050
Cytoplasmic: Score1= 0.369 Score2= 0.290 Weighted Score= 0.659
Mitochondrial: Score1= 0.346 Score2= 0.280 Weighted Score= 0.626
Chloroplast: Score1= 0.350 Score2= 0.280 Weighted Score= 0.630
Endoplasmic
reticulum: Score1= 0.386 Score2= 0.270 Weighted Score= 0.656
Peroxisomal: Score1= 0.380 Score2= 0.670 Weighted Score= 1.050
Lysosomal: Score1=-0.367 Score2= 0.000 Weighted Score=-0.367
Golgi: Score1=-0.041 Score2= 0.290 Weighted Score= 0.249
******************************************
Statistic of the protein localization prediction (%):
Nuclear: 100.00
Plasma membrane: 0.00
Extracellular: 0.00
Cytoplasmic: 0.00
Mitochondrial: 0.00
Chloroplast: 0.00
Endoplasmic
reticulum: 0.00
Peroxisomal: 0.00
Lysosomal: 0.00
Golgi 0.00
---
More information about the Bio-www
mailing list