ProtComp - Version 2: Program for Identification of sub-cellular localization

webmaster webmaster at mail.softberry.com
Tue Oct 24 06:46:09 EST 2000


ProtComp - Version 2: Program for Identification of sub-cellular localization of
Eukaryotic proteins
	
ProtComp is available at: http://www.softberry.com/

                    http://www.softberry.com/pss/pss.html

    ProtComp:  Current, second release ProtComp includes basic scheme of
localization prediction. Third version, which will include additional
signals and compartments, is scheduled for release by the end of the year.

The program is based on complex neural-network recognizers, which identify
probability of the subcellular localization in nucleus, plasma membrane,
extracellular, cytoplasmic, mitochondrial, chloroplast, endoplasmic
reticulum, peroxisomal, lysosomal or Golgi compartments.



Accuracy of prediction tested on known proteins from TREMBL database:

Compartment                   Number tested             % of true predictions
Nuclear                                        154                     87.0
Plasma Membrane                                 80                     90.0
Extracellular                                   74                     64.9
Cytoplasmic                                     23                     56.5
Mitochondrial                                    8                     87.5
Chloroplast                                     17                     64.7
Endoplasmic reticulum                           19                     63.1
Peroxisomal                                      6                     50.0
Lysosomal                                        5                     60.0
Golgi                                           11                     81.8
--------------------------------------------------------------------------------
Total                                          397                     70.5
                                                                
Output results:
Presents scores for different networks and final conclusion in Weighted Score. 


******************************************
Name: >Q9Y6H8_
First three lines of sequence:
MGDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEDVWGDEQSDFTCNTQQPGCENVCYDRAFPISHI
RFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAGALLRTYV
FNIIFKTLFEVGFIAGQYFLYGFELKPLYRCDRWPCPNTVDCFISRPTEKTIFIIFMLAVACASLLLNMLEIYHL


protcomp  Mon Oct 23 17:09:33 EDT 2000
ProtComp Version 2, Softberry Inc., 2000
==============================================
Nuclear:         Score   0.650
Plasma membrane: Score   1.391
Extracellular:   Score   1.094
Cytoplasmic:     Score   0.597
Mitochondrial:   Score   0.647
Chloroplast:     Score   0.606
Endoplasmic 
reticulum:       Score   0.692
Peroxisomal:     Score   1.197
Lysosomal:       Score  -0.065
Golgi:           Score   0.155

 Predicted protein localization: Plasma membrane


---






More information about the Bio-www mailing list