B. subtilis

[Francis Ouellette]

bran at is1e.vub.ac.be (Andre B.) writes:

: Does anybody know what is the nrg29 operon and the nrgA and nrgB
: genes of Bacillus subtilis ? 

a quick gopher search picks up the appended file ... 
if you want to know more about gopher, email Dan Jacobson
(danj at welchdev.welch.jhu.edu) ... (danj at gdb.org??)

he will be more than happy to pass you info to get you started on gopher!

regards,

francis

--
| B.F. Francis Ouellette  
|
| francis at ncbi.nlm.nih.gov   


LOCUS       BACNRGABO    2157 bp ds-DNA             BCT       30-SEP-1992
DEFINITION  Bacillus subtilis operon membrane-associated protein (nrgA) gene,
            complete cds, PII-like protein (nrgB) gene, complete cds.
ACCESSION   L03216
KEYWORDS    PII-like protein; membrane-associated protein; nrg29 operon;
            nrgA gene; nrgB gene.
SOURCE      Bacillus subtilis (strain 168) DNA.
  ORGANISM  Bacillus subtilis
            Prokaryotae; Firmicutes; Endospore-forming rods and cocci;
            Bacillaceae.
REFERENCE   1  (bases 1 to 2157)
  AUTHORS   Wray,L.V.Jr.., Atkinson,M.R. and Fisher,S.H.
  TITLE     Nucleotide sequence of the Bacillus subtilis nrg29 operon
  JOURNAL   Unpublished (1992)
  STANDARD  full automatic
FEATURES             Location/Qualifiers
     CDS             126..1340
                     /function="unknown"
                     /gene="nrgA"
                     /citation=[1]
                     /note="putative"
                     /product="membrane-associated protein"
                     /codon_start=1
                     /translation="MQMGDTVFMFFCALLVWLMTPGLALFYGGMVKSKNVLSTAMHSF
                     SSIAIVSIVWVLFGYTLAFAPGNSIIGGLEWAGLKGVGFDPGDYSDTIPHSLFMMFQM
                     TFAVLTTAIISGAFAERMRFGAFLLFSVLWASLVYTPVAHWVWGGGWIGQLGALDFAG
                     GNVVHISSGVAGLVLAIVLGKRKDGTASSPHNLIYTFLGGALIWFGWFGFNVGSALTL
                     DGVAMYAFINTNTAAAAGIAGWILVEWIINKKPTMLGAVSGAIAGLVAITPAAGFVTP
                     FASIIIGIIGGAVCFWGVFSLKKKFGYDDALDAFGLHGIGGTWGGIATGLFATTSVNS
                     AGADGLFYGDASLIWKQIVAIAATYVFVFIVTFVIIKIVSLFLPLRATEEEESLGLDL
                     TMHGEKAYQDSM"
     CDS             1352..1702
                     /function="unknown"
                     /gene="nrgB"
                     /citation=[1]
                     /note="putative"
                     /product="PII-like protein"
                     /codon_start=1
                     /translation="MSGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQK
                     AHTELYRGVKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISN
                     TINIRTGEEGPEAL"
BASE COUNT      550 a    482 c    512 g    613 t
ORIGIN      
        1 tcgataacat ttctcaaaaa ccatgtcagg aaatcttaca tgaaaatgtt ttatcattct
       61 tttttctcta taatgaagaa atataataat tgctttttat tctgaaagat acggaggaat
      121 gagacatgca aatgggcgat acagttttta tgttcttttg cgctttactc gtgtggctga
      181 tgaccccggg attagcgtta ttttatggag gaatggtaaa gagcaaaaat gtgctgagca
      241 ctgccatgca cagtttctct tccattgcca tcgtttccat cgtttgggtg ctgttcggat
      301 atacacttgc cttcgcacca ggcaattcaa tcatcggcgg gctggagtgg gcaggcctca
      361 aaggggtcgg atttgatccg ggagattaca gcgataccat cccccactcg ttatttatga
      421 tgttccaaat gacgttcgcc gttctgacta cagcgattat ttccggggct ttcgcagagc
      481 ggatgcgatt cggcgctttt cttttattct cggttttatg ggcctctttg gtttacacac
      541 ccgtagcgca ctgggtatgg ggcggcggct ggatcggcca gcttggagcg ctcgatttcg
      601 ctggcggcaa tgttgttcat atttcctccg gggtggcagg acttgttctt gccattgtgc
      661 tcggcaaacg gaaagacggt acagcgtctt ctccgcataa cctcatttac accttcttag
      721 gaggagcttt gatttggttc ggctggttcg gctttaacgt cggcagcgca ttgaccttag
      781 atggtgtggc catgtacgcg ttcatcaaca caaacaccgc ggctgcagcc gggatcgccg
      841 gctggatctt agtagaatgg atcattaaca aaaaaccgac aatgctcgga gcggtatctg
      901 gggcaatcgc cgggcttgtc gccattacgc cggctgccgg atttgtcaca ccgttcgctt
      961 ccattattat cggcatcatc ggcggagctg tttgtttctg gggagtattc tcgcttaaaa
     1021 agaaattcgg atacgacgac gcgcttgacg cctttggcct gcacgggatc ggcggcacat
     1081 ggggcggaat cgcaacagga ttattcgcaa caacctctgt taactcagcg ggcgcagatg
     1141 ggttatttta cggtgatgca agcttaatct ggaaacaaat cgtcgccatc gccgccactt
     1201 atgtttttgt atttattgtc actttcgtta ttattaaaat tgtaagcctc ttccttcccc
     1261 ttcgcgcaac tgaagaagaa gagtcacttg ggcttgactt aacgatgcac ggggaaaaag
     1321 catatcaaga ttctatgtga ggagtgacgc tatgagcggt caaatgttca aggtagaaat
     1381 tgtaacgcgt ccggcaaatt ttgaaaagct gaagcaggaa ctcggaaaaa tcggagtgac
     1441 ctctctgact ttctccaatg tacacggctg cggccttcaa aaagcacata cggagctcta
     1501 tcgaggggta aaaatagaaa gcaatgtata cgagcgttta aaaatagaaa ttgtggtcag
     1561 caaggttcct gttgatcaag tgacagagac cgctaaaagg gtgctgaaaa cgggatcacc
     1621 aggtgacggt aaaatatttg tctatgaaat cagcaatacg atcaacatcc gcacaggcga
     1681 agaaggacct gaagcacttt aatatcggta cgagattcgg acactccgga tctctttttt
     1741 tgtgcacaga atccccccag aaaccgcgat tcctcttcga attctcttca agcgccgtta
     1801 tttcagacaa tctctatttt tatttgaaac ttttcatgag taagattagt ctactaaata
     1861 taaaaatgta aaaggtgatt atttgaacta cgaaattttt aaagcaatcc atggactatc
     1921 tcatcacaat tcagttctcg attccattat ggtcttcatc acggaatatg ccattgtcgc
     1981 ctatgccctt atcctattgg caatctggct gtttgggaac acacaaagca gaaaacatgt
     2041 gctatacgca ggcatcacag gaattgcagg ccttgtgatc aactatttga ttacgcttgt
     2101 ttatttcgaa ccgcgcccgt tcgttgcgca tacagtgcat acactgattc cgcatgc
//