Wanted Receptor Sequences (7-trans-membrane)

Dan Jacobson danj at welchgate.welch.jhu.edu
Wed Mar 24 16:58:22 EST 1993


In article <Roberts_D-230393083608 at riversend.bms.com> Roberts_D at BMS.COM (Dan Roberts) writes:
>We are currently working an a class of seven trans-membrane receptors known
>as the Thrombin Receptor.  I have heard that there is the complete sequence
>for the Mouse Thrombin Receptor somewhere in gene bank I believe.  Is there
>a site from which I could FTP the sequence.  Also..Is anyone out there
>working on any kind of seven Trans-membrane receptors at all??.. I am also
>looking for the Kinemage Rhodopsin receptor.  Does anyone also have any
>suggestions at all on "hot" scientific ftp sites where I could get the
>latest on such receptors...Thanks for your help!!!....Dan

Gopher is a great way to find sequences that you're looking for.

Best of luck,

Dan Jacobson

danj at welchgate.welch.jhu.edu

----------

The Mouse Thrombin Receptor entry in Genbank is as follows:


LOCUS       MUSTHRRCT    1312 bp ss-mRNA            ROD       23-SEP-1992
DEFINITION  Mus musculus thrombin receptor mRNA, complete cds.
ACCESSION   L03529
KEYWORDS    thrombin receptor.
SOURCE      Mus musculus brain cDNA to mRNA.
  ORGANISM  Mus musculus
            Eukaryota; Animalia; Chordata; Vertebrata; Mammalia; Theria;
            Eutheria; Rodentia; Myomorpha; Muridae; Murinae.
REFERENCE   1  (bases 1 to 1312)
  AUTHORS   Coughlin,S.R.
  TITLE     Cloning of cDNA for the mouse thrombin receptor
  JOURNAL   Unpublished (1992)
  STANDARD  full automatic
FEATURES             Location/Qualifiers
     CDS             15..1307
                     /standard_name="mouse thrombin receptor"
                     /product="thrombin receptor"
                     /codon_start=1
                     /translation="MGPRRLLIVALGLSLCGPLLSSRVPMSQPESERTDATVNPRSFF
                     LRNPSENTFELVPLGDEEEEEKNESVLLEGRAVYLNISLPPHTPPPPFISEDASGYLT
                     SPWLTLFMPSVYTIVFIVSLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVL
                     PSKISYYFSGTDWQFGSGMCRFATAAFYYNMYASIMLMTVISIDRFLAVVYPIQSLSW
                     RTLGGANFTCVVIWVMAIMGVVPLLLKEQTTRVPGLNITTCHDLLSENLMQGFYSYYF
                     SAFSAIFFLVPLIVSTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPT
                     NVLLIVHYLFLSDSPGTEAAYFAYLLCVCVTSVSCCIDPLIYYYASSECQRHLYSILC
                     CKESSDPNSCNSTGQLMPSKMDTCSSHLNNSIYKKLLA"
BASE COUNT      247 a    406 c    328 g    331 t
ORIGIN      
        1 ggcagccttg gacaatgggg ccccggcgct tgctgatcgt cgccctcggc ctcagcctgt
       61 gcggtccctt gctgtcttcc cgcgtcccta tgagccagcc agaatcagag aggacagatg
      121 ctacggtgaa cccccgctca ttctttctaa ggaatcccag tgaaaataca tttgaactgg
      181 tccccctggg ggatgaggag gaggaggaga aaaatgaaag cgtcctgctg gagggtaggg
      241 cagtctactt aaatataagc ctccctcctc acacgccgcc tcctcccttc atctccgagg
      301 acgcctccgg atatctgacc agcccctggc tgacgctctt catgccctcc gtgtacacga
      361 ttgtgttcat tgtcagcctt cctctgaacg tcctggccat cgcagtgttc gtcttgagga
      421 tgaaggtcaa gaagccggcc gtggtgtaca tgctgcacct ggccatggcc gacgtgctct
      481 tcgtgtcggt gctcccttcc aagatcagct actacttctc cggcactgat tggcagttcg
      541 ggtctggaat gtgccgtttc gccaccgcag cgttttacta taacatgtac gcctccatca
      601 tgctcatgac ggtcataagc attgaccggt tcctggcggt ggtgtatccg atccagtccc



More information about the Bioforum mailing list