help

alicemx at my-deja.com alicemx at my-deja.com
Thu Oct 28 10:45:56 EST 1999


I got a sequence from genbank, from the introduction you can see that
the exon start from 62, but if you try to translate the sequence to
amino acid sequence you will find you meet two stop codons, gaggatctga
gaaatgtgac , how comes? it is not reasonable? anyone can give me an
explaination? thank you very much!



LOCUS       MUSTCBA01     510 bp    DNA             ROD       27-APR-
1993
DEFINITION  Mouse T-cell receptor germline beta-chain gene constant
region
            (CT), exon 1.ACCESSION   M26053 M23826NID         g201235
VERSION     M26053.1  GI:201235KEYWORDS    T-cell; T-cell receptor.
SEGMENT     1 of 4SOURCE      Mouse (cell line B10.A) liver DNA.
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
Mammalia;
            Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus.
REFERENCE   1  (bases 1 to 510)
  AUTHORS   Gascoigne,N.R.J., Chien,Y.-h., Becker,D.M., Kavaler,J. and
            Davis,M.M.
  TITLE     Genomic organization and sequence of T-cell receptor beta-
chain
            constant- and joining-region genes
  JOURNAL   Nature 310, 387-391 (1984)  MEDLINE   84270704
FEATURES             Location/Qualifiers     source          1..510
                     /organism="Mus musculus"
                     /db_xref="taxon:10090"     intron          <1..61
                     /gene="TCR"     exon            62..>436
                     /gene="TCR"                     /number=1
     CDS             join(62..436,M26054.1:61..78,M26055.1:29..135,
                     M26056.1:82..102)                     /partial
                     /gene="TCR"                     /codon_start=3
                     /product="T cell receptor"
                     /protein_id="AAA40199.1"
                     /db_xref="PID:g201240"
                     /db_xref="GI:201240"

/translation="DLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSW

WVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEED

KWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVST
                     LVVMAMVKRKNS"     intron          437..>510
                     /gene="TCR"BASE COUNT      137 a    131 c    141
g    101 t
ORIGIN      Chromosome 6.
        1 ttacaagatc aaggcagatc cagatagctc tcagaccatt cgtactctct
ttactttcca
       61 gaggatctga gaaatgtgac tccacccaag gtctccttgt ttgagccatc
aaaagcagag
      121 attgcaaaca aacaaaaggc taccctcgtg tgcttggcca ggggcttctt
ccctgaccac
      181 gtggagctga gctggtgggt gaatggcaag gaggtccaca gtggggtcag
cacggaccct
      241 caggcctaca aggagagcaa ttatagctac tgcctgagca gccgcctgag
ggtctctgct
      301 accttctggc acaatcctcg caaccacttc cgctgccaag tgcagttcca
tgggctttca
      361 gaggaggaca agtggccaga gggctcaccc aaacctgtca cacagaacat
cagtgcagag
      421 gcctggggcc gagcaggtaa gtgggacttg gggagctggc aagaagaata
agcatcagtc
      481 gtgccaatga aaaaatggaa agatgcaggt


Sent via Deja.com http://www.deja.com/
Before you buy.



More information about the Cellbiol mailing list