NEW gene-finder FGENESH parameters for
webmaster
webmaster at softberry.com
Mon Jun 4 21:51:16 EST 2001
NEW gene-finder FGENESH parameters for MOUSE genes
New gene-finder parameters for Mouse is developed
for
FGENESH HMM based multiple gene prediction in
genomic DNA
Mouse specific parameters provide better accuracy
than using Human parameters.
It is available at:
http://www.softberry.com/nucleo.html
TO USE a specific version check organism button,
FGENESH button and click
Perform searh
Past your sequence to the window or load your
file with sequence in FASTA
fromat
Example of an output of the program for Mouse
genomic DNA,
where fgenesh predicted exactly ALL 30 exons:
fgenesh Mon Jun 4 22:41:38 EDT 2001
FGENESH 1.1 Prediction of potential genes in Mouse
genomic DNA
Time : Mon Jun 4 22:41:38 2001
Seq name: BAT2, intron-exon boundaries defined in
relation to human cDNA in M33509. Alt [AF109719 ]
Length of sequence: 14123
Number of predicted genes 1 in +chain 1 in -chain 0
Number of predicted exons 30 in +chain 30 in -chain
0
Positions of predicted genes and exons:
G Str Feature Start End Score
ORF Len
1 + 1 CDSf 201 - 312 11.96
201 - 311 111
1 + 2 CDSi 805 - 982 10.66
807 - 980 174
1 + 3 CDSi 1275 - 1374 6.44
1276 - 1374 99
1 + 4 CDSi 1470 - 1542 8.15
1470 - 1541 72
1 + 5 CDSi 1707 - 1850 11.53
1709 - 1849 141
1 + 6 CDSi 2005 - 2156 2.37
2007 - 2156 150
1 + 7 CDSi 2352 - 2431 7.33
2352 - 2429 78
1 + 8 CDSi 2590 - 2732 5.54
2591 - 2731 141
1 + 9 CDSi 2997 - 3087 14.28
2999 - 3085 87
1 + 10 CDSi 3194 - 3404 22.69
3195 - 3404 210
1 + 11 CDSi 3771 - 4248 40.31
3771 - 4247 477
1 + 12 CDSi 4601 - 4791 11.59
4603 - 4791 189
1 + 13 CDSi 5005 - 5305 37.21
5005 - 5304 300
1 + 14 CDSi 5626 - 5836 22.85
5628 - 5834 207
1 + 15 CDSi 5977 - 7818 139.11
5978 - 7816 1839
1 + 16 CDSi 8124 - 8392 18.83
8125 - 8391 267
1 + 17 CDSi 8588 - 8718 12.84
8590 - 8718 129
1 + 18 CDSi 8947 - 9076 6.48
8947 - 9075 129
1 + 19 CDSi 9177 - 9262 14.21
9179 - 9262 84
1 + 20 CDSi 9444 - 9677 17.54
9444 - 9677 234
1 + 21 CDSi 9819 - 9959 13.12
9819 - 9959 141
1 + 22 CDSi 10061 - 10132 5.47
10061 - 10132 72
1 + 23 CDSi 10399 - 10566 14.32
10399 - 10566 168
1 + 24 CDSi 12282 - 12367 10.06
12282 - 12365 84
1 + 25 CDSi 12476 - 12686 14.76
12477 - 12686 210
1 + 26 CDSi 12858 - 12956 3.52
12858 - 12956 99
1 + 27 CDSi 13063 - 13275 13.29
13063 - 13275 213
1 + 28 CDSi 13390 - 13484 9.79
13390 - 13482 93
1 + 29 CDSi 13584 - 13674 13.39
13585 - 13674 90
1 + 30 CDSl 13783 - 13923 12.35
13783 - 13923 141
1 + PolA 14083 1.41
Predicted protein(s):
>FGENESH: 1 30 exon (s) 201 - 13923 2157
aa, chain +
SDRSGPTAKGKDGKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPA
LPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQPPESQPLPASQTASN
PKRPPTAPENTPSVPSGVKSWAQASVTHGAHGDGGRASNLLSRFSREEFPTLQAADQD
AAKERESAEQSSGPGPSLRPQNSTTWRDGGGRGPDDLEGPDSKLHHGHDPRGGLQSGP
..............
---
=====
Moderated
bionet.genome.gene-structure
____________________________________________________________
Do You Yahoo!?
Get your free @yahoo.co.uk address at http://mail.yahoo.co.uk
or your free @yahoo.ie address at http://mail.yahoo.ie
More information about the Genstruc
mailing list