tell me how to unstand this EST display

sdyang at china.com sdyang at china.com
Sat Jul 22 09:56:28 EST 2000


 I have search this EST from webpage of bioinfo.okstate.edu ,It will be useful to me .But there are some scientific items I can not know its meaning ,such as score,expect,positives .I need your kind help .Furthmore ,I hope you can tell how to use EST database to identify a new cDNA .you may refer me some useful articles which have explain EST more detailed .

Thank you 
sdyang

Contig contig2000Jan241456_1087 Retrieved Successfully !!! 


The Retrieved Contig Data is as follows :


Contig Name,No.of one-line Descriptions,Characters In Sequence,Average of Score in Bits(Max Score,Min Score)
> contig2000Jan241456_1087!5!700!106.40(110, 101)!
 Sequences Producing Significant Alignments                        Score   E      Identities      Positives
                                                                 (Bits) Value
gi|3318617|dbj|BAA31585.1| (AB016066) mitochondrial phosphate transporter [Arabidopsis                       !110! 1e-23!    52/56 (92%)!    56/56 (99%)!
gi|3318611|dbj|BAA31582.1| (AB016063) mitochondrial phosphate transporter [Glycine max]                      !109! 3e-23!    52/56 (92%)!    55/56 (97%)!
gi|3318613|dbj|BAA31583.1| (AB016064) mitochondrial phosphate transporter [Zea mays]                         !106! 1e-22!    51/56 (91%)!    54/56 (96%)!
gi|3318615|dbj|BAA31584.1| (AB016065) mitochondrial phosphate transporter [Oryza sativa]                     !106! 1e-22!    51/56 (91%)!    54/56 (96%)!
gi|1842188|emb|CAA69726.1| (Y08499) mitochondrial phosphate translocator [Betula pendula]                    !101! 8e-21!    48/56 (85%)!    52/56 (92%)!
 Significant Alignments :
 gi|3318617|dbj|BAA31585.1| (AB016066) mitochondrial phosphate transporter [Arabidopsis            thaliana]
           Length = 288
           
 Score =  110 bits (272), Expect = 1e-23
 Identities = 52/56 (92%), Positives = 56/56 (99%)
Query: 58  LSFLNNAKGATVGDAVKKIGVLGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 225
           +SFLNNAKGATVGDAVKKIG++GLFTRGLPLRIVMIGTLTGAQWG+YDAFKVFVGL
Sbjct: 214 VSFLNNAKGATVGDAVKKIGMVGLFTRGLPLRIVMIGTLTGAQWGLYDAFKVFVGL 269
  gi|3318611|dbj|BAA31582.1| (AB016063) mitochondrial phosphate transporter [Glycine max]            Length = 375
           
 Score =  109 bits (269), Expect = 3e-23
 Identities = 52/56 (92%), Positives = 55/56 (97%)
Query: 58  LSFLNNAKGATVGDAVKKIGVLGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 225
           +SFLNNAKGATVGDAVKK+G+ GLFTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL
Sbjct: 299 VSFLNNAKGATVGDAVKKLGLWGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 354
  gi|3318613|dbj|BAA31583.1| (AB016064) mitochondrial phosphate transporter [Zea mays]            Length = 366
           
 Score =  106 bits (263), Expect = 1e-22
 Identities = 51/56 (91%), Positives = 54/56 (96%)
Query: 58  LSFLNNAKGATVGDAVKKIGVLGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 225
           +SFLNNAKGATVGDAVKK+G+ GLFTRGLPLRIVMIGTLTGAQWGIYDAFKV VGL
Sbjct: 291 VSFLNNAKGATVGDAVKKLGLWGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVMVGL 346
  gi|3318615|dbj|BAA31584.1| (AB016065) mitochondrial phosphate transporter [Oryza sativa]            Length = 368
           
 Score =  106 bits (263), Expect = 1e-22
 Identities = 51/56 (91%), Positives = 54/56 (96%)
Query: 58  LSFLNNAKGATVGDAVKKIGVLGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 225
           +SFLNNAKGATVGDAVKK+G+ GLFTRGLPLRIVMIGTLTGAQWGIYDAFKV VGL
Sbjct: 292 VSFLNNAKGATVGDAVKKLGLWGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVMVGL 347
  gi|1842188|emb|CAA69726.1| (Y08499) mitochondrial phosphate translocator [Betula pendula]            Length = 364
           
 Score =  101 bits (248), Expect = 8e-21
 Identities = 48/56 (85%), Positives = 52/56 (92%)
Query: 58  LSFLNNAKGATVGDAVKKIGVLGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 225
           +SFLNNAKGATVGDAVKK+G+LGL TRGLPLRI M+GTLTG QWGIYDAFKV VGL
Sbjct: 291 VSFLNNAKGATVGDAVKKMGLLGLCTRGLPLRIFMVGTLTGVQWGIYDAFKVSVGL 346
 ssion library, 30 hours NaCl treatment Mesembryanthemum crystallinum cDNA clone L30-2603 5', mRNA sequenceTCTCTTTCCTCAA Nucleotide Sequence for Contig contig2000Jan241456_1087 : 
CAATGCCAAGGGAGCTACTGTTGGTGATGCCGTTAAGAAGATCGGTGTGTTGGGTCTTTTCACTCGTGGACTTCCTCTCCGTATTGTCATGATTGGTACCCTCACCGGAGCACAATGGGGTATCTATGATGCATTCAAAGTCTTTGTTGGGCTGCCAACAACTGGTGGTGCTCCTCCTGCTGCTGCCCCTGCTAAGGTATGAAGATATTGACGAATAGAAGAGAATCACGGGTTTTGGATATTTGGAAGGAGTGTTAATAAACACCAGGATTTGCTGATATTTTTGCTCACTGGATAGTGGGAAAACGATAATTTTTGTTTACTTGAGACCATAATTCATAACATTCTGCAATTAGTTCTGATAATACGTTTATGAAGGATGGTTTTGTCCTCATCCTTCATTCCTGAAAGCTCCTTCAAAGTACCGTGTTAGATAAATGTAGGACATGGTTTTTGTTGTTTCTTTTTCGACCCCAACTAGGAACTGGCAACAGGTGATATTGGGGAATCATACTTCGGTTATATTCTTTTGACAGAGCTATCGTTGCTGTTTAAGTGAAACAACAATTTATTTTTGGCTT


----------------------------------------------
»¶Ó­²Î¼ÓCNNICÓн±µ÷²é,´ó½±µÈ×ÅÄú£¡
ÇëͶƱ֧³ÖÖлªÍø!
http://www.china.com/zh_cn/cnnic/
ÇëͶƱ֧³Ö¹úÖÐÍø!
http://cww.com/cnnic.html


---






More information about the Methods mailing list