pCD2 plasmid map

Peter Ellis via methods%40net.bio.net (by pjie2 from cam.ac.uk)
Fri Dec 4 16:48:22 EST 2009


Don't have a map to hand, but here's the fourth hit from a Google search 
for "pCD2 sequence".

http://downloads.yeastgenome.org/sequence/vector/AF134166.gb

Given the sequence, working out a restriction map should be simple :-)

Peter

****************

LOCUS       AF134166     6220 bp    DNA             SYN       30-DEC-1999
DEFINITION  Yeast 2-hybrid vector pCD.2 complete sequence.
ACCESSION   AF134166
VERSION     AF134166.1  GI:6642844
KEYWORDS    .
SOURCE      Yeast 2-hybrid vector pCD.2.
   ORGANISM  Yeast 2-hybrid vector pCD.2
             artificial sequence; vectors.
REFERENCE   1  (bases 1 to 6220)
   AUTHORS   Durfee,T., Draper,O., Zupan,J., Conklin,D.S. and Zambryski,P.C.
   TITLE     New tools for protein linkage mapping and general two-hybrid
             screening
   JOURNAL   Yeast 15 (16), 1761-1768 (1999)
   MEDLINE   20060013
    PUBMED   10590464
REFERENCE   2  (bases 1 to 6220)
   AUTHORS   Durfee,T., Draper,O. and Zupan,J.
   TITLE     Direct Submission
   JOURNAL   Submitted (11-MAR-1999) Plant and Microbial Biology, UC 
Berkeley,
             111 Koshland Hall, Berkeley, CA 94720, USA
FEATURES             Location/Qualifiers
      source          1..6220
                      /organism="Yeast 2-hybrid vector pCD.2"
                      /db_xref="taxon:111294"
      rep_origin      1..362
                      /note="ColE1 replication origin cloned from pRS314;
                      Sikorski, RS and Hieter, P. 1989"
      gene            complement(934..1794)
                      /gene="bla"
      CDS             complement(934..1794)
                      /gene="bla"
                      /note="confers ampicillin resistance; cloned from 
pRS314;
                      Sikorski, RS and Hieter, P. 1989"
                      /codon_start=1
                      /product="beta-lactamase"
                      /protein_id="AAF20321.1"
                      /db_xref="GI:6642845"
 
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
 
IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE
 
YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFFHNMGDHVTRL
 
DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
 
LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                      EIGASLIKHW"
      misc_feature    2028..2053
                      /note="CEN6: CDEI fragment of chromosome VI centromere
                      from S.cerevisiae; cloned from pRS314; Sikorski, 
RS and
                      Hieter, P. 1989"
      misc_feature    2066..2442
                      /note="ARS4:  Autonomous replicating sequence fragment
                      near gene for histone 4 on chromosome II in S. 
cerevisiae;
                      cloned from pRS314; Sikorski, RS and Hieter, P. 1989"
      gene            2976..3650
                      /gene="TRP1"
      CDS             2976..3650
                      /gene="TRP1"
                      /note="cloned from pRS314; Sikorski, RS and Hieter, P.
                      1989"
                      /codon_start=1
                      /product="n-(5'-phosphoribosyl)-anthranilate 
isomerase"
                      /protein_id="AAF20322.1"
                      /db_xref="GI:6642846"
 
/translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNR
 
KRTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGD
 
ESWQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSI
 
SDWVGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANF
                      VKNAKK"
      promoter        4437..5165
                      /note="ADC1 promoter (PADH) cloned from pAS1; 
Durfee, T.
                      1993"
      CDS             5166..>5607
                      /note="binds UASG site  cloned from pAS1; Durfee, T.
                      1993."
                      /codon_start=1
                      /product="GAL4 DNA binding domain"
                      /protein_id="AAF20323.1"
                      /db_xref="GI:6642847"
 
/translation="MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKT
 
KRSPLTRAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNV
                      NKDAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVS"
      misc_feature    5661..5700
                      /note="hemagglutinin epitope cloned from pAS1; 
Durfee, T.
                      1993"
      misc_feature    5661..5730
                      /note="multiple cloning site (NdeI, SfiI, NcoI, SmaI,
                      BamHI, SalI, PstI) cloned from pAS1; Durfee, T. 1993"
      terminator      5748..5938
                      /note="ADC1 transcriptional terminator (TADH) 
cloned from
                      pAS1; Durfee, T. 1993."
BASE COUNT     1748 a   1353 c   1417 g   1702 t
ORIGIN
         1 ttcctcgctc actgactcgc tgcgctcggt cgttcggctg cggcgagcgg tatcagctca
        61 ctcaaaggcg gtaatacggt tatccacaga atcaggggat aacgcaggaa agaacatgtg
       121 agcaaaaggc cagcaaaagg ccaggaaccg taaaaaggcc gcgttgctgg cgtttttcca
       181 taggctcggc ccccctgacg agcatcacaa aaatcgacgc tcaagtcaga ggtggcgaaa
       241 cccgacagga ctataaagat accaggcgtt cccccctgga agctccctcg tgcgctctcc
       301 tgttccgacc ctgccgctta ccggatacct gtccgccttt ctcccttcgg gaagcgtggc
       361 gctttctcaa tgctcacgct gtaggtatct cagttcggtg taggtcgttc gctccaagct
       421 gggctgtgtg cacgaacccc ccgttcagcc cgaccgctgc gccttatccg gtaactatcg
       481 tcttgagtcc aacccggtaa gacacgactt atcgccactg gcagcagcca ctggtaacag
       541 gattagcaga gcgaggtatg taggcggtgc tacagagttc ttgaagtggt ggcctaacta
       601 cggctacact agaaggacag tatttggtat ctgcgctctg ctgaagccag ttaccttcgg
       661 aaaaagagtt ggtagctctt gatccggcaa acaaaccacc gctggtagcg gtggtttttt
       721 tgtttgcaag cagcagatta cgcgcagaaa aaaaggatct caagaagatc ctttgatctt
       781 ttctacgggg tctgacgctc agtggaacga aaactcacgt taagggattt tggtcatgag
       841 attatcaaaa aggatcttca cctagatcct tttaaattaa aaatgaagtt ttaaatcaat
       901 ctaaagtata tatgagtaaa cttggtctga cagttaccaa tgcttaatca gtgaggcacc
       961 tatctcagcg atctgtctat ttcgttcatc catagttgcc tgactgcccg tcgtgtagat
      1021 aactacgata cgggagggct taccatctgg ccccagtgct gcaatgatac cgcgagaccc
      1081 acgctcaccg gctccagatt tatcagcaat aaaccagcca gccggaaggg ccgagcgcag
      1141 aagtggtcct gcaactttat ccgcctccat ccagtctatt aattgttgcc gggaagctag
      1201 agtaagtagt tcgccagtta atagtttgcg caacgttgtt gccattgcta caggcatcgt
      1261 ggtgtcacgc tcgtcgtttg gtatggcttc attcagctcc ggttcccaac gatcaaggcg
      1321 agttacatga tcccccatgt tgtgaaaaaa agcggttagc tccttcggtc ctccgatcgt
      1381 tgtcagaagt aagttggccg cagtgttatc actcatggtt atggcagcac tgcataattc
      1441 tcttactgtc atgccatccg taagatgctt ttctgtgact ggtgagtact caaccaagtc
      1501 attctgagaa tagtgtatgc ggcgaccgag ttgctcttgc ccggcgtcaa tacgggataa
      1561 taccgcgcca catagcagaa ctttaaaagt gctcatcatt ggaaaacgtt cttcggggcg
      1621 aaaactctca aggatcttac cgctgttgag atccagttcg atgtaaccca ctcgtgcacc
      1681 caactgatct tcagcatctt ttactttcac cagcgtttct gggtgagcaa aaacaggaag
      1741 gcaaaatgcc gcaaaaaagg gaataagggc gacacggaaa tgttgaatac tcatactctt
      1801 cctttttcaa tattattgaa gcatttatca gggttattgt ctcatgagcg gatacatatt
      1861 tgaatgtatt tagaaaaata aacaaatagg ggttccgcgc acatttcccc gaaaagtgcc
      1921 acctgggtcc ttttcatcac gtgctataaa aataattata atttaaattt tttaatataa
      1981 atatataaat taaaaataga aagtaaaaaa agaaattaaa gaaaaaatag tttttgtttt
      2041 ccgaagatgt aaaagactct agggggatcg ccaacaaata ctacctttta tcttgctctt
      2101 cctgctctca ggtattaatg ccgaattgtt tcatcttgtc tgtgtagaag accacacacg
      2161 aaaatcctgt gattttacat tttacttatc gttaatcgaa tgtatatcta tttaatctgc
      2221 ttttcttgtc taataaatat atatgtaaag tacgcttttt gttgaaattt tttaaacctt
      2281 tgtttatttt tttttcttca ttccgtaact cttctacctt ctttatttac tttctaaaat
      2341 ccaaatacaa aacataaaaa taaataaaca cagagtaaat tcccaaatta ttccatcatt
      2401 aaaagatacg aggcgcgtgt aagttacagg caagcgatcc gtcctaagaa accattatta
      2461 tcatgacatt aacctataaa aataggcgta tcacgaggcc ctttcgtctc gcgcgtttcg
      2521 gtgatgacgg tgaaaacctc tgacacatgc agctcccgga gacggtcaca gcttgtctgt
      2581 aagcggatgc cgggagcaga caagcccgtc agggcgcgtc agcgggtgtt ggcgggtgtc
      2641 ggggctggct taactatgcg gcatcagagc agattgtact gagagtgcac cataaacgac
      2701 attactatat atataatata ggaagcattt aatagacagc atcgtaatat atgtgtactt
      2761 tgcagttatg acgccagatg gcagtagtgg aagatattct ttattgaaaa atagcttgtc
      2821 accttacgta caatcttgat ccggagcttt tctttttttg ccgattaaga attaattcgg
      2881 tcgaaaaaag aaaaggagag ggccaagagg gagggcattg gtgactattg agcacgtgag
      2941 tatacgtgat taagcacaca aaggcagctt ggagtatgtc tgttattaat ttcacaggta
      3001 gttctggtcc attggtgaaa gtttgcggct tgcagagcac agaggccgca gaatgtgctc
      3061 tagattccga tgctgacttg ctgggtatta tatgtgtgcc caatagaaag agaacaattg
      3121 acccggttat tgcaaggaaa atttcaagtc ttgtaaaagc atataaaaat agttcaggca
      3181 ctccgaaata cttggttggc gtgtttcgta atcaacctaa ggaggatgtt ttggctctgg
      3241 tcaatgatta cggcattgat atcgtccaac tgcatggaga tgagtcgtgg caagaatacc
      3301 aagagttcct cggtttgcca gttattaaaa gactcgtatt tccaaaagac tgcaacatac
      3361 tactcagtgc agcttcacag aaacctcatt cgtttattcc cttgtttgat tcagaagcag
      3421 gtgggacagg tgaacttttg gattggaact cgatttctga ctgggttgga aggcaagaga
      3481 gccccgaaag cttacatttt atgttagctg gtggactgac gccagaaaat gttggtgatg
      3541 cgcttagatt aaatggcgtt attggtgttg atgtaagcgg aggtgtggag acaaatggtg
      3601 taaaagactc taacaaaata gcaaatttcg tcaaaaatgc taagaaatag gttattactg
      3661 agtagtattt atttaagtat tgtttgtgca cttgcctgcg gtgtgaaata ccgcacagat
      3721 gcgtaaggag aaaataccgc atcaggaaat tgtaaacgtt aatattttgt taaaattcgc
      3781 gttaaatttt tgttaaatca gctcattttt taaccaatag gccgaaatcg gcaaaatccc
      3841 ttataaatca aaagaataga ccgagatagg gttgagtgtt gttccagttt ggaacaagag
      3901 tccactatta aagaacgtgg actccaacgt caaagggcga aaaaccgtct atcagggcga
      3961 tggcccacta cgtgaaccat caccctaatc aagttttttg gggtcgaggt gccgtaaagc
      4021 actaaatcgg aaccctaaag ggagcccccg atttagagct tgacggggaa agccggcgaa
      4081 cgtggcgaga aaggaaggga agaaagcgaa aggagcgggc gctagggcgc tggcaagtgt
      4141 agcggtcacg ctgcgcgtaa ccaccacacc cgccgcgctt aatgcgccgc tacagggcgc
      4201 gtcgcgccat tcgccattca ggctgcgcaa ctgttgggaa gggcgatcgg tgcgggcctc
      4261 ttcgctatta cgccagctgg cgaagggggg atgtgctgca aggcgattaa gttgggtaac
      4321 gccagggttt tcccagtcac gacgttgtaa aacgacggcc agtgaattgt aatacgactc
      4381 actatagggc gaattggagc tccaccgcgg tggcggccgc tctagaacta gatatccttt
      4441 tgttgtttcc gggtgtacaa tatggacttc ctcttttctg gcaaccaaac ccatacatcg
      4501 ggattcctat aataccttcg ttggtctccc taacatgtag gtggcggagg ggagatatac
      4561 aatagaacag ataccagaca agacataatg ggctaaacaa gactacacca attacactgc
      4621 ctcattgatg gtggtacata acgaactaat actgtagccc tagacttgat agccatcatc
      4681 atatcgaagt ttcactaccc tttttccatt tgccatctat tgaagtaata ataggcgcat
      4741 gcaacttctt ttcttttttt ttcttttctc tctcccccgt tgttgtctca ccatatccgc
      4801 aatgacaaaa aaaatgatgg aagacactaa aggaaaaaat taacgacaaa gacagcacca
      4861 acagatgtcg ttgttccaga gctgatgagg ggtatcttcg aacacacgaa actttttcct
      4921 tccttcattc acgcacacta ctctctaatg agcaacggta tacggccttc cttccagtta
      4981 cttgaatttg aaataaaaaa agtttgccgc tttgctatca agtataaata gacctgcaat
      5041 tattaatctt ttgtttcctc gtcattgttc tcgttccctt tcttccttgt ttctttttct
      5101 gcacaatatt tcaagctata ccaagcatac aatcaactcc aagcttgaag caagcctcct
      5161 gaaagatgaa gctactgtct tctatcgaac aagcatgcga tatttgccga cttaaaaagc
      5221 tcaagtgctc caaagaaaaa ccgaagtgcg ccaagtgtct gaagaacaac tgggagtgtc
      5281 gctactctcc caaaaccaaa aggtctccgc tgactagggc acatctgaca gaagtggaat
      5341 caaggctaga aagactggaa cagctatttc tactgatttt tcctcgagaa gaccttgaca
      5401 tgattttgaa aatggattct ttacaggata taaaagcatt gttaacagga ttatttgtac
      5461 aagataatgt gaataaagat gccgtcacag atagattggc ttcagtggag actgatatgc
      5521 ctctaacatt gagacagcat agaataagtg cgacatcatc atcggaagag agtagtaaca
      5581 aaggtcaaag acagttgact gtatcgccgg aattcatggc ttacccatac gatgttccag
      5641 attacgctag cttgggtggt catatggcca tggacctagg cagatctgat caagggatcc
      5701 cgggtcgacc tgcagccaag ctaattccgg gcgaatttct tatgatttat gatttttatt
      5761 attaaataag ttataaaaaa aataagtgta tacaaatttt aaagtgactc ttaggtttta
      5821 aaacgaaaat tcttgttctt gagtaactct ttcctgtagg tcaggttgct ttctcaggta
      5881 tagcatgagg tcgctcttat tgaccacacc tctaccggca tgcgacgtcg ggcccggtac
      5941 ccagcttttg ttccctttag tgagggttaa ttccgagctt ggcgtaatca tggtcatagc
      6001 tgtttcctgt gtgaaattgt tatccgctca caattccaca caacatagga gccggaagca
      6061 taaagtgtaa agcctggggt gcctaatgag tgaggtaact cacattaatt gcgttgcgct
      6121 cactgcccgc tttccagtcg ggaaacctgt cgtgccagct gcattaatga atcggccaac
      6181 gcgcggggag aggcggtttg cgtattgggc gctcttccgc
//


More information about the Methods mailing list