Genetic Code for Mycoplasma

Brian Foley btf at t10.lanl.gov
Wed Mar 5 19:58:20 EST 1997


Todd Charles Wood wrote:
> 
> Does anyone have a reference for the Mycoplasma genetic code?
> Or just the code?  Either one is fine.
> 
> Thanks,
> 
> Todd Wood
> tcw3r at virginia.edu

Here are the first and last segments of the complete genome:
The others have accession numbers and LOCUS names intermediate
between these.

LOCUS       MPAE000063   1843 bp    DNA             BCT      
18-NOV-1996
DEFINITION  Mycoplasma pneumoniae from bases 815265 to 663 (section 63
of 63)
            of the complete genome.
ACCESSION   AE000063 U00089
NID         g1674383
KEYWORDS    .
SOURCE      Mycoplasma pneumoniae.
  ORGANISM  Mycoplasma pneumoniae
            Eubacteria; Firmicutes; Low G+C gram-positive bacteria;
Mycoplasmas
            and walled relatives; Mycoplasmatales; Mycoplasmataceae;
            Mycoplasma.
REFERENCE   1  (bases 1 to 1843)
  AUTHORS   Himmelreich,R., Hilbert,H., Plagens,H., Pirkl,E., Li,B.C.
and
            Herrmann,R.
  TITLE     Complete sequence analysis of the genome of the bacterium
            Mycoplasma pneumoniae
  JOURNAL   Nucleic Acids Res. 24 (22), 4420-4449 (1996)
  MEDLINE   97105885
REFERENCE   2  (bases 1 to 1843)
  AUTHORS   Himmelreich,R., Hilbert,H. and Li,B.-C.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-NOV-1996) Zentrun fuer Molekulare Biologie
            Heidelberg, University Heidelberg, 69120 Heidelberg, Germany
FEATURES             Location/Qualifiers
     source          1..1843
                     /organism="Mycoplasma pneumoniae"
                     /strain="M129"
                     /note="ATCC 29342"
     CDS             complement(171..1793)
                     /partial
                     /gene="nusA"
                     /note="E07_orf540o; N-utilization substance protein
A
                     homolog; similar to Swiss-Prot Accession Number
P32727,
                     from B. subtilis"
                     /codon_start=1
                     /db_xref="PID:g1674384"
                     /transl_table=4
                    
/translation="MNNQSNHFTNPLLQLIKNVAETKNLAIDDVVLCLKTALAQTYKK
                    
HLNYVNVEVNIDFNKGLMQIEQLFDVVDDNNEDYDDFLEMPLSEAKKLNPNLEVGGVL
                    
RKPVSLKDIKGDLISKMVLLFNQKINETAFKTVMSDFINEVGQVIEARVEDIDTNKDG
                    
GLKGYIVNLETTKGYMPKRELSKGEKLDIGKKYLFVIKEIQKQSSMWPITLSRSDSRL
                    
LEFLLNSNTPEIANGTIEIKKMERSPGTKSKVAVISKDPVVDPIAAILGPKGERIRGI
                    
SEEFNGEIIDIVIWNEDKLKFLVNAVLPAEVVGYNILQDDERDTSIEIVVPANQIANV
                    
FGFKGINIRLISNLTGWSSVDVYTEKDAAEQGIEFTRVNFQPQGIFGIKKRRDKISNN
                    
PRNNNQQLASDKVFYTSKANVVDDEIIVDLAKQAEAKRVKQIKQEATKPELQLQQELN
                    
LEATPKVAAPTPTPAPQPTPAPTKVEPVPPPVSVTPKPIPKVNKPKPVVKPKSVFSIT
                     VEADDSKTKPEKSSAKTNTPQTKQTFDNFDDL"
BASE COUNT      466 a    391 c    396 g    590 t
ORIGIN      
        1 aaagcagcta cacttaaata atacccccga cctggtagtg tttgcgctaa
atccacccgt
       61 agttgatgct ctaattttac aagacgcaaa agtagcggct tagcaaaaga
ctttctggta
      121 actaaacatt ggcgccaact ttgcatagtg tgaaatggtt agattaacga
ctagagatcg
      181 tcaaagttat caaaggtttg tttcgtttgt ggggtgttag ttttagcgct
tgacttttct
      241 ggtttagtct tactgtcatc cgcttcaacc gtaatcgaaa agactgattt
tggtttaacc
      301 actggcttgg gcttattgac cttggggatt ggcttaggtg taacgcttac
tggtggtggt
      361 actggctcaa ctttagttgg tgcgggagtt ggttggggtg caggggttgg
ggttggagca
      421 gctaccttag gggttgcttc gaggttaagt tcttgttgta attgcaactc
gggtttagtt
      481 gcttcctgct tgatttgctt gacccgtttg gcttccgctt gctttgctag
atcgactatg
      541 atctcatcat caaccacatt ggccttcgaa gtgtaaaaca ccttatcaga
tgcgagctgt
      601 tggttgttgt tgcgtggatt gttggagatc ttgtcgcggc gctttttgat
gccaaaaata
      661 ccttggggtt gaaagttgac ccgggtgaat tcaatccctt gttcagcagc
atctttttcg
      721 gtgtaaacgt ccacactact ccaacccgtt aggttactaa ttaagcgaat
gttaattcct
      781 ttaaaaccaa agacgttggc aatctggttg gcgggtacca cgatttcaat
gctggtatcg
      841 cgctcatcgt cttgaaggat gttgtaaccg accacttcag ccggtaaaac
agcgttgacc
      901 aagaacttta acttgtcctc atttcagatg acaatatcaa tgatctcacc
gttaaactct
      961 tcactaatgc cgcgaatgcg ctcgcccttg ggacccaaaa tggccgcaat
cggatcaact
     1021 actgggtctt tggaaatcac ggccacctta gacttggtac caggagagcg
ttccatcttt
     1081 ttaatttcga tcgtaccgtt agcaatttcg ggagtgttgg aatttagcaa
gaattccagt
     1141 aaacgcgaat cactcctgga aagcgtaatt ggtcacatcg aagattgctt
ttggatttcc
     1201 ttaatcacaa agaggtactt cttgccaata tctagctttt cgcccttact
caactcacgt
     1261 ttaggcatgt aacccttggt ggtttccaag ttaacaatgt aacccttcaa
tccaccatct
     1321 ttgttcgtat caatgtcctc tactctagct tcaattacct gaccgacttc
attaatgaag
     1381 tcactcatca ccgttttaaa agctgtttcg ttaatctttt ggttgaagag
taataccatt
     1441 ttgctaatga gatcgccctt aatgtctttg agtgaaaccg gtttgcgcaa
caccccgcca
     1501 acttctaggt tcggattgag cttcttagcc tcacttaaag gcatttccaa
aaagtcatca
     1561 taatcctcat tgttatcatc tacaacatcg aagagctgtt caatttgcat
taagcccttg
     1621 ttaaagtcaa tgttgacttc cacattgaca tagttcaaat gcttcttgta
tgtttgtgct
     1681 aatgctgttt taagacacaa aacaacatca tcgatggcta aattcttggt
ctcggcaacg
     1741 ttcttaatca gttgtaacaa aggattggta aagtgatttg attgattgtt
cataatgtga
     1801 taaagtgggc aaataaaaaa gaagtgccta gcgacacttc tct
//




Views:     
Links:     


LOCUS       MPAE000001   9255 bp    DNA             BCT      
18-NOV-1996
DEFINITION  Mycoplasma pneumoniae from bases 664 to 9918 (section 1 of
63) of
            the complete genome.
ACCESSION   AE000001 U00089
NID         g1673645
KEYWORDS    .
SOURCE      Mycoplasma pneumoniae.
  ORGANISM  Mycoplasma pneumoniae
            Eubacteria; Firmicutes; Low G+C gram-positive bacteria;
Mycoplasmas
            and walled relatives; Mycoplasmatales; Mycoplasmataceae;
            Mycoplasma.
REFERENCE   1  (bases 1 to 9255)
  AUTHORS   Himmelreich,R., Hilbert,H., Plagens,H., Pirkl,E., Li,B.C.
and
            Herrmann,R.
  TITLE     Complete sequence analysis of the genome of the bacterium
            Mycoplasma pneumoniae
  JOURNAL   Nucleic Acids Res. 24 (22), 4420-4449 (1996)
  MEDLINE   97105885
REFERENCE   2  (bases 1 to 9255)
  AUTHORS   Himmelreich,R., Hilbert,H. and Li,B.-C.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-NOV-1996) Zentrun fuer Molekulare Biologie
            Heidelberg, University Heidelberg, 69120 Heidelberg, Germany
FEATURES             Location/Qualifiers
     source          1..9255
                     /organism="Mycoplasma pneumoniae"
                     /strain="M129"
                     /note="ATCC 29342"
     CDS             complement(77..3418)
                     /note="E07_orf1113; MG140 homolog, from M.
genitalium"
                     /codon_start=1
                     /db_xref="PID:g1673646"
                     /transl_table=4
                    
/translation="MNDWQWLKNRLVNAKTKAVSFWLAQTTSTILDIAELIKCCSDLK
                    
NTSINGLVDLINQQEKLEFNLTRLKEIDGEDARQLFGIEGNVYKHFQTELSRFYKQTR
                    
KHFRETGSESLFLGLPVIEGINEFNDVFRAPLLYVGVKLKVAPRLERFWLEINREEIF
                    
LNPTIIGVEINKRNSLFKNNYDTTKVDINQALEIFRELEYQFRMPLTSELKSFSKKAK
                    
SDFNTEKRTNFLTNNVLLGIFDVKGDQLFQNFNEILNTDPDVLDELLKDRRDLLYDNR
                    
EFRENFNLKGTYLFSHLDIFQQYAVKQAFDGDVIIEGPPGTGKSETIVNILVNLALNK
                    
KKVLFVSEKVTALDVVYNRLGSFKHIALFNASVASEKKRFYSQFADYESFFTDNFSKK
                    
DLVNEMPVFDGQWVDKILSEFTNLQNIYDTQINSGNQSYSFKEILSSFPILDVSYIKI
                    
KEHDRFDEWVRVFSSQVWLEKHLTYLAFKAELSKRWQNIDNFYALKDLLEKRKNIRVL
                    
CYVLDYFEQNNSIIKPKRVLLYTPTERGQKQLHQLQQDVAKYNSLQRFKSAAKFETIK
                    
LNLANKLAQNAKPFFFSWFIQTHAQTLLENLVQTQKQLVKAKQSYLSKIEQYVVSCKR
                    
ILKATILANFFELYQTNKNELLDICREAKNPVLKEITWWFKKNFALLSKLFPVHIMTF
                    
ESAALLTPNQRRLYDYVVIDEASQVYLERAIPILYRGAKYIIAGDTKQLKPSNFFQAR
                    
AEYDVDEEFEDGNVEAAVHSTSLLHFLKNRSRILTLLKFHYRSDSANLIAFTNNRIYN
                    
NELIFMNKATADKQVFIVHDVIDGIWRNNRNLQEARDVVQRLEQLTQTAEYQKSLGVI
                    
CFNKNQAELIEYMIDKQNNPLLNEWRDRVNAQGEYVGLFVKNIENVQGDERDIIIFSL
                    
GYDRSVNSYGPISKQGGENRLNVAITRAKQRIELFKTNRASDYNGLSSNSLGSKLLVE
                    
YLLYCEAMANNQGESLDFQATQKQAPKAKYELELENQFFNELELIFGEQFTIKRNVNE
                    
GAYSFSFVFYFNENPYLAVDFNPALPHSRKEVSENIIYREQFLKKRKWNLVNIWLDEW
                     KLNPGGVLQKLRNCLTHSENEFEEI"
     CDS             complement(3594..5978)
                     /note="E07_orf794; putative lipoprotein, MG260
homolog,
                     from M. genitalium"
                     /codon_start=1
                     /db_xref="PID:g1673647"
                     /transl_table=4
                    
/translation="MKFKYGAIVFSGLLGVSAILAACGARGKFNQVDDGKIKLASSLT
                    
SRSASTALQKVVEKYNKVKGVNDYPIEITQIAGGYDGGRTDLQTRVNVKDTTNFYNLI
                    
LNYPDLVSTLGRVGMELPFDKVKTDKLADRFLDFNNRISAISKKGIYGIPVSLSTEVL
                    
SINGPVLHYILNSAQGKVSSVTSVQRTADSGSGTTNNNGVTKPLKIDKENESTKKLWE
                    
EIENKAKENGKKTSSSRRKRNLSSSKQMSTQTQPTDNSNDANQSDQAIEKTWGKYQEV
                    
EGGLKDYTFKASVFENWHDLLDFSNRVAKSFSNINTNTNKKGTDIQGVLGIDSTPNSL
                    
FTSVFAAGGGNYDNFFYKVANGRADFSNFKNKGTSYQNLQKVYGDYKGLIDSNGLFVN
                    
KGGSYSSNFQKFHQLAYSISSTSGFFYSFAGENSKRLKFDGGNFIEFPGFTQAIYAPE
                    
NNSQSGGESGDQTTNNEANLLGTFKIKSSNKSKSSSSKSSTKAETGKTSGGDQNQGKK
                    
GEGAQNQGKKGEGAQNQGKNGGVETTIYLYKNSIPSGKNKGENAILIDNKTIVEQLES
                    
AAKKEDKKSGESTTEQTQIQSKSVTEQKQPKIIGYTTTGNVHEDNKHIFPIDKLTSDR
                    
NFDRKIIVGATEETLDKSNTLQSNEAIVLPAPSKYKSTDTNKVTITQGPNIIGIHVNE
                    
KENAETQKFVDWFLNSPQTWEGKGKGKEQTNKTAAEFFAESASYILPLKEIFEQKNEK
                    
KEGSDQKDSKSNGRGKQTNLYTEKALELFRGISTDQIVSYSDQVTLGVVVSVME"
     CDS             complement(6261..6662)
                     /note="E07_orf133; E07_orf133 Protein"
                     /codon_start=1
                     /db_xref="PID:g1673648"
                     /transl_table=4
                    
/translation="MEFNGNLNHMEKRKSGYVTQKQFNEYKDSNDQRLIKIETTLAAQ
                    
GEQISQLVQIVFLQGKQIKELQAEQKAQRVEFNARMDRFESLVLKSLESIGNTLTDFG
                     KRFDSMETRLDSMDGRLDSMETRLDKIDPPK"
     CDS             complement(7145..7819)
                     /note="E07_orf224; hypothetical 130K protein
homolog;
                     similar to GenBank Accession Number JS0069, from M.
                     pneumoniae"
                     /codon_start=1
                     /db_xref="PID:g1673649"
                     /transl_table=4
                    
/translation="MGSNAVPSLWYWVVDERTTSGRGTWWAHTELNWGTDKQKEFVEN
                    
QLGFNETSATDSHNFKKALLHQPAYLISGLDVVADHLVFAAFRAGAVGYDMTTDTNAS
                    
TYNQALTWSTTAGLDSAGGYKALVENTAGLNGPINGLFTLLDTFAYVTPVSGMKGGSK
                    
NTEAVQTTYPVKSDQKASAKIASLINASPLNSYGDKKSHPPKVKGRQLQNIFDDWKLT
                     KAVSLM"
     repeat_region   complement(7233..7957)
                     /rpt_family="REPMP5"
     CDS             complement(7647..8951)
                     /note="E07_orf434; hypothetical 130K protein
homolog;
                     similar to GenBank Accession Number JS0069, from M.
                     pneumoniae"
                     /codon_start=1
                     /db_xref="PID:g1673650"
                     /transl_table=4
                    
/translation="MAVGIFILSLNPSYELVDWKRVGDTKLVALVRSALVRVKFNDGT
                    
SSDSNNQDTNQNALSFDTQESQKALNGSQSGSSDTSGSNSQDFASYILIFQAAPRATW
                    
VFERKIKLELPYVKNESGAGDSTTTNSGSLYTTLQDLLVEQPVTPYTPNAGLARVNGA
                    
AQDTVHFGSGQESSWNSQRSQKVLKNNPGPKAVTGFKLDKGRAYRKLNEAWPVYEPLD
                    
STKDGKGKDESSWNSSEKTTAESDAPLVGSTGSQMAAVTDSQQSGDNNGLVSLAQRST
                    
TVAVQKSDSSGSQGQGTTDNKFQKYLNTTQALHQMGVIVPSLETWAGENKYWNRYPCC
                    
WWCFSPSSDPAIVFHKWRSTECNHPVIPYFNRPTRLLKWPDRCDGFERGTEFVVLGRG
                     WANHVRKGYLMSPHRVELGHRQAEGVCGESAWFQWNQRHRLA"
     misc_feature    complement(77..3418)
                     /note="E07_orf1113"
     misc_feature    complement(3594..5978)
                     /note="E07_orf794"
     misc_feature    complement(6261..6662)
                     /note="E07_orf133"
     misc_feature    complement(7145..7819)
                     /note="E07_orf224"
     misc_feature    complement(7647..8951)
                     /note="E07_orf434"
BASE COUNT     2483 a   1913 c   1828 g   3031 t
ORIGIN      
        1 aatgtgataa agtgggcaaa taaaaaagaa gtgcctagcg acacttctct
taaatgacga
       61 gaaatatatc gtttaattat atttcttcaa actcattttc gctgtgagtt
agacaatttc
      121 taagcttttg caacacacca cctggattga gttttcactc gtctaaccaa
atgttaacga
      181 ggttccattt ccgctttttc aaaaattgtt cgcggtaaat aatgttttca
ctcacttcct
      241 ttctggagtg gggtaaagca gggttaaagt caaccgctag gtaagggttt
tcgttaaagt
      301 aaaagacaaa gctaaagctg tatgcaccct cattgacatt gcgtttaatc
gtaaactgct
      361 caccaaaaat aagttccaac tcattaaaga actggttctc caattccaat
tcgtacttgg
      421 ccttgggtgc ttgtttttgg gttgcttgga agtctaagct ctcaccctgg
ttgttggcca
      481 ttgcctcaca gtacagtaag tattccacca ataacttact acccaaggaa
ttggagctca
      541 aaccattgta atcactagca cggttagtct tgaacagttc aatccgctgc
ttagcacggg
      601 taatcgctac attcaaacgg ttctccccac cttgcttgga aatcgggcca
tagctgttga
      661 cagaacggtc atagcccaac gagaagataa taatgtcccg ttcatcaccc
tgaacgtttt
      721 caatgttttt gacaaacaaa ccgacatact cgccctgagc gttcacccgg
tcacgtcact
      781 cattgagtag cggattgttc tgcttgtcaa tcatgtactc aattaactcg
gcctgatttt
      841 tattgaaaca gatcacccct aatgattttt gatattccgc agtttgggtc
aactgttcta
      901 agcgttgtac gacatcgcgt gcttcttgaa ggttacggtt gttccgtcaa
ataccatcga
      961 tgacatcatg gacaataaag acctgcttgt cagcggttgc tttattcata
aagatgagct
     1021 cgttgttata aatgcggtta ttagtaaagg caattaggtt agcggaatca
ctgcggtagt
     1081 ggaatttgag cagcgttaaa atgcgcgaac ggttcttcaa aaagtgtagt
aacgaagtcg
     1141 agtgcaccgc agcttcaacg ttaccatctt caaactcttc atccacatca
tactcagccc
     1201 gggcttggaa gaaattggat ggttttaatt gtttggtgtc tccagcaata
atgtacttag
     1261 cgccacggta taagattgga atggcacgtt ctagataaac ctggctagct
tcatcaatca
     1321 ccacatagtc atacaaacgg cgctggttcg gggttaataa ggcggctgat
tcaaacgtca
     1381 taatgtggac ggggaatagc tttgataaca gtgcaaagtt cttcttaaac
caccaggtaa
     1441 tttcctttaa aacagggttt ttggcttccc gacagatatc caatagttca
ttcttattgg
     1501 tttggtacaa ctcaaagaag ttggctaaaa tggtagcttt gagaatccgt
ttacaactaa
     1561 ctacatactg ctcaattttg cttaagtagc tttgcttagc cttaaccaat
tgcttttggg
     1621 tttgtacgag attttccaac agtgtttgcg cgtgtgtttg aatgaatcaa
gaaaagaaaa
     1681 aaggcttggc gttttgtgct agtttgttag ctaaattgag cttaattgtt
tcaaacttag
     1741 cagccgattt aaaacgttgc aagctgttgt acttagcaac gtcttgctgg
agttggtgca
     1801 actgcttttg cccgcgttca gtgggggtat agagcaatac ccgcttcggt
ttgattatgc
     1861 tgttgttctg ctcgaagtaa tccaacacat agcacaacac gcggatgttc
tttctttttt
     1921 ccagtaagtc ttttaaagcg tagaagttat cgatgttttg tcagcgtttg
ctcagttccg
     1981 ctttaaacgc taagtaagtt aagtgttttt ctaatcaaac ttgtgaggaa
aatacccgca
     2041 ctcattcatc aaaacgatcg tgttccttga tcttaatgta actgacatca
agtattggaa
     2101 aactacttag gatttccttg aaggaatagc tctggttacc cgaattaatt
tgggtatcgt
     2161 aaatgttttg aaggttagtg aattcactta ggatcttatc aacccactgc
ccgtcaaaca
     2221 ccggcatttc gttaactaaa tccttcttgg aaaagttatc ggtaaagaag
ctttcataat
     2281 cagcgaactg gctgtaaaag cgcttcttct cactcgctac cgaagcatta
aataaggcaa
     2341 tgtgcttaaa gctacctagc cggttgtaaa cgacatctaa ggcagttacc
ttttctgaca
     2401 caaacaacac cttctttttg tttaaagcga ggttgaccaa gatgttgaca
atcgtttcac
     2461 tcttaccagt accaggtgga ccttcaataa tgacatcccc atcaaatgcc
tgtttgacag
     2521 cgtactgctg gaagatgtct aagtggctaa agaggtaagt gccctttaag
ttaaagtttt
     2581 cacgaaactc acggttgtcg tataagagat cgcggcgatc ctttaacaat
tcatccaaaa
     2641 catcaggatc agtgtttaga atttcgttaa agttttggaa cagttgatcc
cccttaacgt
     2701 caaagattcc taaaagaacg ttattagtga ggaagttagt ccgtttttca
gtgttaaagt
     2761 cactcttagc ctttttggaa aaacttttta actccgaggt gagtggcatc
cgaaattggt
     2821 attccaactc acgaaagatt tccaatgcct ggttaatatc aaccttagtg
gtgtcatagt
     2881 tatttttaaa caagctgtta cgcttgttaa tttcaacccc gatgatggtc
ggatttaaaa
     2941 agatttcctc gcggtttatt tccaatcaaa agcgttcaag tcgtggtgct
acttttaact
     3001 taacccccac atagagtaaa ggagcacgaa agacatcgtt aaactcgtta
atgccctcaa
     3061 ttactggtaa acctaaaaag agactttccg aaccagtttc gcgaaagtgt
ttgcgcgttt
     3121 gcttgtaaaa gcgactaagt tcagtttgga agtgtttgta aacattacct
tcaatgccaa
     3181 acaactgtcg tgcatcctcg ccatcaattt cctttaacct tgttaagtta
aattcgagtt
     3241 tttcttgttg gtttataaga tcaactaacc cattaatgga agtattcttt
aaatccgaac
     3301 aacatttaat tagttcagca atatctaaga tggtgctggt agtttgggct
agccagaaac
     3361 taacagcctt agttttggcg ttaaccagcc ggtttttgag tcactgtcag
tcgttcatgg
     3421 agtcgtctaa attgctttaa agcattattt gattataaag cgctagcttt
atgaaaccct
     3481 tgactggact gcaaaagtga ttagctaaat atcactacct aaagttgcaa
taaagttttg
     3541 aacaaacttt tcaaaagatg ctttagagct tactgctgcg ttaaaagtgg
cacctattcc
     3601 atcacggaaa cgaccactcc taaagtcact tggtcactgt aacttactat
ttgatcggta
     3661 ctaatacctc taaatagttc caaggccttt tcggtgtaga ggttagtttg
tttacctcta
     3721 ccattgcttt tactatcttt ttgatcgctg ccttctttct tttcattctt
ttgctcaaaa
     3781 atttccttga gtggcaagat ataagaagcc gattcagcaa agaattcagc
tgcggtttta
     3841 ttagtttgtt ctttaccttt tcccttaccc tctcaagttt gcggactgtt
taagaatcaa
     3901 tccacaaact tttgtgtttc tgcattttcc ttttcgttga cgtgaattcc
aatgatattc
     3961 ggaccttggg tgatggttac tttgttagtg tcagtacttt tgtacttaga
gggtgctggt
     4021 aaaacaatgg cttcattgga ctgcaaagta ttcgatttat cgagtgtttc
ttcagtggca
     4081 ccaacaataa ttttgcggtc aaaatttcga tcagatgtaa gtttgtcaat
tgggaaaatg
     4141 tgtttgttgt cttcgtgaac attgccagtg gtagtgtaac cgatgatttt
gggttgtttt
     4201 tgttctgtta cacttttact ttgtatttgt gtctgttctg tggtagattc
gccactcttc
     4261 ttatcttctt ttttagccgc actttctagt tgttccacaa tagttttgtt
atctataaga
     4321 attgcatttt cgcctttatt ttttccagat ggaattgagt ttttataaag
gtaaatagtt
     4381 gtttctacac ctccgttttt gccttgattt tgagcgcctt cgcctttttt
gccttgattt
     4441 tgagcgcctt cgcctttttt gccttggttt tggtctccac cactagtttt
gcctgtttcg
     4501 gctttagtgc ttgatttgga acttgaagat ttagatttat tagagctttt
tattttgaaa
     4561 gtgcctaaaa gattggcttc attatttgtg gtttgatcgc cactctctcc
accactttga
     4621 ctattatttt caggcgcata aattgcttga gtaaatccag gaaactcaat
aaaattaccg
     4681 ccatcaaact tcaagcgctt tgagttttca ccagcaaacg agtagaagaa
gccggaagtc
     4741 gaggaaatac tgtaagctaa ttggtgaaac ttttggaagt tcgatgaata
agaaccaccc
     4801 ttattgacaa agagaccatt gctgtcaatc aagcctttgt aatcaccata
aactttttgt
     4861 aagttttggt aagaagtgcc tttattctta aagttactaa agtcagcccg
accgtttgca
     4921 accttataaa agaagttgtc atagttaccg ccacctgcag caaaaacaga
ggtaaataag
     4981 gagttaggag tgctatcgat tcccagaaca ccttgaatat cggtgccctt
tttattggtg
     5041 ttagtgttta tattgctaaa tgacttagct accctattag aaaagtcaag
caaatcgtgt
     5101 cagttttcaa acacactggc tttgaaggtg taatctttta aaccaccttc
aacctcctga
     5161 tatttacccc aagtcttttc tatcgcctgg tcgctttgat tagcatcgtt
actattgtca
     5221 gtaggttgag tttgagtgct catttgttta gaactactta aatttctttt
tcttcttgaa
     5281 gaactcgttt tcttaccgtt ttcttttgcc ttgttttcta tttcttctca
aagtttcttt
     5341 gtagattcat tttctttatc aatcttcaaa ggttttgtta ctccattatt
atttgttgtt
     5401 ccactaccag aatctgctgt tctttgcacc gaagtgacag aactaacctt
tccttgtgca
     5461 ctattcaaaa tatagtgcaa aacgggtcca ttaatcgata aaacttcggt
ggataaagaa
     5521 accggaatgc cataaatgcc ctttttggaa atggcactaa tacggttgtt
gaaatccaaa
     5581 aaacggtcag ctaacttatc agttttaacc ttatcaaaag gtagttccat
cccaacacgt
     5641 cccaaagtgg aaactaagtc gggatagttc aagatgaggt tataaaaatt
agtcgtgtct
     5701 ttaacgttaa ctcgggtttg tagatcagtc cgcccgccat cataaccgcc
agcaatttgg
     5761 gtaatttcaa tggggtaatc atttacgcct ttaaccttgt tatacttttc
aacaactttt
     5821 tgtaaagctg ttgacgcact tctggaagtt aaagatgaag ctagcttaat
cttgccatca
     5881 tcaacttggt taaatttgcc ccttgcccca caggcagcta aaatggccga
aacgcccaaa
     5941 agaccactaa aaacaatagc gccgtactta aatttcataa acactagaaa
cccgaaattt
     6001 agagaaatat taacaaagtt tgtagatgtt taacccttga aatttactag
tttgagttac
     6061 tgaagtaaaa gtatttttaa aagcaaattt tgactgtttt taattaatta
aaagttgaat
     6121 gtttaaatgg ttctactcag tgtgttatta tttttttttg aaattacttt
taaaaccaat
     6181 tttggtcgtt aaatcgtttt agcttttttg tgaataaaaa taccaaaaac
agtttagctg
     6241 ctggtatttt tagcttaaaa ctatttaggt ggatcgattt tgtctaaacg
agtttccatt
     6301 gaatcgagac gaccatccat agagtccaaa cgagtttcca ttgaatcgaa
tcgtttacca
     6361 aaatcagtca aagtgtttcc gattgattcc agactcttaa gcacaaggct
ttcaaagcga
     6421 tccatgcgcg cgttaaattc aactctttgt gctttttgct ccgcttgaag
ttctttaatt
     6481 tgttttcctt ggaggaacac aatttgaact agctgactaa tttgctcacc
ttgggcagcc
     6541 aaagtagttt caatctttat gagccgttgg tcgtttgagt ctttatattc
gttaaactgc
     6601 ttttgggtaa cataaccact ttttcgtttt tccatatggt ttaaattgcc
attaaattcc
     6661 atgtcgtagc taccatcagg taactcttct tcccaaacat gacaattatt
aatcttatct
     6721 ttgttgagtc ttttcttaaa caaagtaagt gaaattgtgc gtttaatggt
gaagacctcc
     6781 tttattattg attggaaaaa cgtaaaaatg tttaaggagg tggttcgtca
ctggtcactg
     6841 aacgagtttg aaacctaatt ggaagttgtt aatttttaat ttaaacatta
tgagtcttta
     6901 cactaactaa attgcttaaa gttagtaaag acaccaaaat aacttcaaaa
cttttttgaa
     6961 agtaaaagtt cctattaata gttagaaggg attacaaacc caaattgcaa
aatattcaaa
     7021 ctttttgact actttgaaaa tctttctcaa tttatttagt gggagcaggc
agagtgactt
     7081 gtgttgaaaa aacgagcctg ctcccgctga tttaaataaa tttagtaaat
tcatagtttt
     7141 gcctctacat caaactaaca gcttttgtta gttttcaatc gtcaaaaata
ttttggagct
     7201 gtctgccttt caccttaggt ggatggcttt ttttatcccc ataactgttg
agtggactgg
     7261 cattaattaa ggacgcaatt ttggcggaag ccttttggtc ggacttgacc
ggataagtcg
     7321 tttgcactgc ctccgtattc ttactccccc ctttcatccc actcaccggg
gtcacatacg
     7381 caaaggtgtc gagcagggta aacaagccgt taatcgggcc gttgagcccg
gccgtgtttt
     7441 ccaccaaggc cttgtacccc ccagcactgt ccaacccggc cgtggtcgac
caggtgagcg
     7501 cttggttgta ggtcgaagcg ttcgtatcag tcgtcatatc ataccccacc
gcgccggctc
     7561 gaaaggccgc aaagacgagg tggtcggcca caacgtcaag gccactgatg
aggtaggcgg
     7621 gttgatgtaa cagcgctttt ttaaagttat gcgagtcggt ggcgctggtt
tcattgaaac
     7681 caagctgatt ctccacaaac tccttctgct tgtcggtgcc ccagttcaac
tcggtgtggg
     7741 ctcatcaagt accccttccg gacgtggttc gctcatccac gacccaatac
cacaaactcg
     7801 gtaccgcgtt cgaacccatc acaacgatct ggccatttaa gtaagcgagt
tgggcggttg
     7861 aagtatggta taactgggtg attacattcg gtagatcttc atttgtggaa
gacgattgcc
     7921 gggtcgctgc ttggactgaa acaccaccag cagcacgggt agcgattcca
gtacttgttt
     7981 tcccccgccc acgtttccaa agatggcact atcaccccca tctggtgcag
ggcctgggtg
     8041 gtgttgaggt atttttggaa tttgttatcg gttgtgcctt ggccttgaga
accagaagag
     8101 tcactttttt ggacagcaac agtagtggag cgctgggcaa gcgataccaa
tccattgtta
     8161 tcacctgatt gctgactgtc tgtgactgca gccatttgac tcccggttga
tcccaccaac
     8221 ggggcatcac tttccgccgt tgttttttcc gaactgttcc aagagctctc
atccttcccc
     8281 ttgccatcct tggtcgaatc caggggttca tacaccggtc aagcttcatt
tagcttccgg
     8341 tacgcgcggc ccttatcgag cttaaagccg gtgacggctt tgggtccggg
gttgttttta
     8401 aggacttttt gggaacgttg ggaattccaa ctcgattctt gacccgaacc
aaaatgaacc
     8461 gtatcctgag cagccccatt cacccgggct aaccccgcat tgggcgtgta
aggggtcacg
     8521 ggttgttcga cgaggaggtc ttggagggtg gtgtagaggg agccactgtt
agttgtggtg
     8581 gagtcccctg ctcccgattc gtttttaacg tagggcaact ctaacttaat
cttccgttca
     8641 aacacccacg tggccctggg cgcggcttgg aagatgagga tgtagctggc
gaagtcttgg
     8701 gagttagacc cggaagtgtc agaagatcca ctctgcgagc cattaagtgc
cttctgtgat
     8761 tcttgggtat caaaactcaa ggcattttga ttcgtatctt ggttattaga
atccgaactc
     8821 gtcccatcat taaacttcac cctgaccaac gctgagcgga ccagcgccac
caacttggta
     8881 tcacccaccc gctttcagtc cacgagttcg tatgaggggt ttagtgaaag
aataaaaata
     8941 ccaacagcca tgcattaact gctggtattt tatactgcta gctttttctc
tgctctttta
     9001 agaattcaat aaactgattt aaaaacaatt caagctctaa agacatttta
tctggcttcc
     9061 tttgagtgtt tgaatctttg tctttaatgt tcatcgttac ataaatttca
ttaactccat
     9121 cagcagtgta tttattactt aataaataag ataaaatttc agaatcactt
aatacttcta
     9181 tcattctttc aacagaagct ttctctgtaa cctttacttt tttaatggtc
aaatcctcct
     9241 ttcttttgat ttttt
//
-- 
 ____________________________________________________________________
|Brian T. Foley                btf at t10.lanl.gov                      |
|HIV Database                  (505) 665-1970                        |
|Los Alamos National Lab       http://hiv-web.lanl.gov/index.html    |
|Los Alamos, NM 87544  U.S.A.  http://retro.lanl.gov/~btf/home.html  |
|____________________________________________________________________|



More information about the Mol-evol mailing list