signal peptides

Calimero guidok at telebyte.nl
Tue Oct 1 04:17:52 EST 1996


Hi,

I used a computer program to find signal peptides in a putative protein and
it gave the following results:

Maximum score 3.5 at residue 46

Sequence:  ACLFRAVADQVYG-DQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEM
            | (signal)    | (mature peptide)
           33             46

Score 3.5 at residue 166

Sequence:  VGLGLPSFKPGFA-EQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNESIEEQVARESYLQW
            | (signal)    | (mature peptide)
          153             166

Does anybody know what these signals mean. 


Guido

guidok at telebyte.nl





More information about the Proteins mailing list