PDISORDER: A new Program for Finding Intrinsic Distorder Regions in Protein Sequences

softberry at softberry.com softberry at softberry.com
Wed Jul 30 18:29:47 EST 2003


PDISORDER: A new Program for Finding Intrinsic Distorder Regions in Protein 
Sequences

PDISORDER V. 1.0 is the program for predicting ordered and disordered regions 
in 
protein sequences. Minimum required sequence length is 40. The algorithm is 
based on 
three-layered neural net with 10 neurons in each layer. 

 You can run program at: 

 http://www.softberry.com/berry.phtml?
topic=pdisorder&group=programs&subgroup=propt

or  from Protein Structure Sub-menu at www.softberry.com

It is increasingly evident that intrinsically unstructured protein regions 
play 
key roles in cell-signaling, regulation and cancer 
(Iakoucheva et al., J. Mol. Biol. (2002) 323, 573-584), 
which makes them extremely useful for discovery of anticancer drugs. 
Requrement of intrinsic structural distorder is shown for many protein 
functions - see, 
for instance, Dunker et al., Biochemistry (2002) 41 (21), 6573 -6582. 

Example of PDISORDER output: 

Prediction of disordered regions in proteins. Softberry Inc.
>gi|1352677|sp|P48457|P2B_EMENI Ser/thr protein phosphatase 2B catalytic 
    subunitCalmodulin-dependent calcineurin A subunit)
                    10        20        30        40      
 Pred_od    ooooooooo    ddd ooooooooooooooooooooooooooooooooo
 AA seq     MEDGTQVSTLERVVKEVQAPALNKPSDDQFWDPEEPTKPNLQFLKQHFYR
 Prob_o     66666665655663335777766565589767999999999999997999
                    60        70        80        90      
 Pred_od    oooooooooooooooooooooooooooooooooooooooooooooooooo
 AA seq     EGRLTEDQALWIIQAGTQILKSEPNLLEMDAPITVCGDVHGQYYDLMKLF
 Prob_o     99999999999999999999999999999999999999999999999999
                   110       120       130       140      
 Pred_od    oooooooooooooooooooooooooooooooooooooooooooooooooo
 AA seq     EVGGDPAETRYLFLGDYVDRGYFSIECVLYLWALKIWYPNTLWLLRGNHE
 Prob_o     99999999999999999999999999999999999999999999999999
                   160       170       180       190      
 Pred_od    oooooooooooooooooooooooooooooooooooooooooooooooooo
 AA seq     CRHLTDYFTFKLECKHKYSERIYEACIESFCALPLAAVMNKQFLCIHGGL
 Prob_o     99999999999999999999999999999999999997555556887888
                   210       220       230       240      
 Pred_od    oooooooooooooooooooooooooooooooooooooooooooooooooo
 AA seq     SPELHTLEDIKSIDRFREPPTHGLMCDILWADPLEDFGQEKTGDYFIHNS
 Prob_o     78775555553563478776666666678689999999999999999999
                   260       270       280       290      
 Pred_od    oooooooooooooooooooooooooooooooooooooooooooooooooo
 AA seq     VRGCSYFFSYPAACAFLEKNNLLSVIRAHEAQDAGYRMYRKTRTTGFPSV
 Prob_o     99999999999999999999999999999999999999999999999999
                   310       320       330       340      
 Pred_od    oooooooooooooooooooooooooooooooooooooooooooooooooo
 AA seq     MTIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCTPHPYWLPNFMDVFTW
 Prob_o     99999999999999999999999999999999999999999999999999
                   360       370       380       390      
 Pred_od    ooooooooooo           dddddddddddddddddddddddddddd
 AA seq     SLPFVGEKITDIVIAILNTCSKEELEDETPSTISPAEPSPPMPMDTVDTE
 Prob_o     99999976656555554444441100000000000000000000000000
                   410       420       430       440      
 Pred_od    dddddddddddddddddddddddddddddddddddddddddddddddddd
 AA seq     STEFKRRAIKNKILAIGRLSRVFQVLREESERVTELKTAAGGRLPAGTLM
 Prob_o     00000000000100000000001223333444444333422232555555
                   460       470       480       490      
 Pred_od    dddddddddddddddddddddddddddddddddddddddddddddddddd
 AA seq     LGAEGIKQAITNFEDARKVDLQNERLPPSHDEVVRRSEEERRIALDRAQH
 Prob_o     55555433255544555565443400000231112100000000000001
                   510       520      
 Pred_od    dddddddddddddddddddddddddddddd
 AA seq     EADNDTGLATVARRISMVRRIRKIPSTTRR
 Prob_o     020000022332232444444444443343


sequences=1 disordered=161 ordered=353 unknown=16


Here line Pred_od shows ordered (o) and disordered (d) regions. Blanks denote 
undefined-state stretches, usually at the boundaries of disordered reqions. 

Line Prob_o shows raw probability on a scale of 0 to 9 for each aminoacid 
residue to be in ordered region. 

The line at the end of the output shows total number of sequence residues i
n each state: disordered, ordered and unknown. 

---



More information about the Proteins mailing list