[Protein-analysis] Re: unknown tag sequence

darked via proteins%40net.bio.net (by darek.kedra from gmail.com)
Wed Apr 16 05:56:45 EST 2008


On Apr 15, 8:31 pm, "Luke" <ke... from yahoo.com> wrote:
> We got a vector from another lab.
> After sequencing, I found a fragment besides target gene:
> SDPLVQCGGILQISSTVAAARGHPFEGKPIPNPLLGLDSTRTG
>
> Anybody knows what is the name of this tag?
> I tried BLAST, but still have no idea.
>
> Luke

It is in your blastp results:
i.e.:   AAU14794. Reports  neurotrophin 3 pr...[gi:51949752]

V5 epitope tag (GKPIPNPLLGLDST).

Best,

darked
http://openwetware.org/wiki/Wikiomics
http://openwetware.org/wiki/Wikiomics:Bioinfo_tutorial


More information about the Proteins mailing list