[Protein-analysis] Re: unknown tag sequence

Luke via proteins%40net.bio.net (by ke_lu from yahoo.com)
Wed Apr 16 09:58:09 EST 2008


darked,

Thanks very much for your help.
Is SDPLVQCGGILQISSTVAAARGHPFE a tag?

Luke

"darked" <darek.kedra from gmail.com> wrote in message 
news:b7ee045b-e46b-4766-ba30-65120fe8a43f from 2g2000hsn.googlegroups.com...
> On Apr 15, 8:31 pm, "Luke" <ke... from yahoo.com> wrote:
>> We got a vector from another lab.
>> After sequencing, I found a fragment besides target gene:
>> SDPLVQCGGILQISSTVAAARGHPFEGKPIPNPLLGLDSTRTG
>>
>> Anybody knows what is the name of this tag?
>> I tried BLAST, but still have no idea.
>>
>> Luke
>
> It is in your blastp results:
> i.e.:   AAU14794. Reports  neurotrophin 3 pr...[gi:51949752]
>
> V5 epitope tag (GKPIPNPLLGLDST).
>
> Best,
>
> darked
> http://openwetware.org/wiki/Wikiomics
> http://openwetware.org/wiki/Wikiomics:Bioinfo_tutorial 




More information about the Proteins mailing list