yeast vector pRS416 sequence?


Fri Nov 5 12:09:20 EST 1993


In article <9311042153.AA05353 at net.bio.net>, REINEROA at PT.CYANAMID.COM
("REINERO ANTONIO") wrote:
> 
> Can anyone provide the nucleotide sequence of the yeast shuttle vector pRS416
> in electronic format? Thanks
> Antonio Reinero
> Plant Biotechnology
> American Cyanamid
> P.O. Box 400 
> Princeton, NJ 08540

The following is the nucleotide sequence of the yeast shuttle vector pRS416
in electronic format. please let me know if it is what you wanted.

SRVSVMTVKTSDTCSSRRRSQLVCKRMPGADKPVRARQRVLAGVGAGLTMRHQSRLYZECTIPQLFNSIHHFFFILFFDF
GFFEIFLIRZSPNRRKNEGRSTDLDWYIYAYVVLKKHEIAQYSZPNCTEQKPAGNEDKSCRKLHIRNVLLLILVLLLPSY
LISCTKSKQTCVLHWMFVPPRNYWSZLKHZVPKFVYZKHMWISZLIFPWRAQLSRZRHYPPSTIFYSSKTENLLTLVIQS
NCSTLRVYTEZQNGQTLRMHTVWWAQVLLAVZSRRQKKZQRNLEAFZCZQNCHARAPYLLENILRVLLTLRRATKILLSA
LLLKETWVEEMKVTIGZLZHPVWVZMTRETHWVNSIEPWMMWSLQDLTLLLLEEDYLQREGMLRZRVNVTEKQAGKHIZE
DAASKTKKLYYKZMHVYZTHKLELQFNYISYYPMRCEIPHRCVRRKYRIRKLZTLIFCZNSRZIFVKSAHFLTNRPKSAK
SLINQKNRPRZGZVLFQFGTRVHYZRTWTPTSKGEKPSIRAMAHYVNHHPNQVFWGRGAVKHZIGTLKGAPDLELDGESR
RTWRERKGRKRKERALGRWQVZRSRCAZPPHPPRLMRRYRARRAIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGDZVG
ZRQGFPSHDVVKRRPVSARNTTHYRANWVPGPPSRSTVSISLISNSCSPGDPLVLERPPPRWSSSFCSLZZGLIARLAZS
WSZLFPVZNCYPLTIPHNIGAGSIKCKAWGAZZVRZLTLIALRSLPAFQSGNLSCQLHZZIGQRAGRGGLRIGRSSASSL
TDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNMZAKGQQKARNRKKAALLAFFHRLRPPDEHHKNRRSSQRWRNPTG
LZRYQAFPPGSSLVRSPVPTLPLTGYLSAFLPSGSVALSHSSRCRYLSSVZVVRSKLGCVHEPPVQPDRCALSGNYRLES
NPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYTRRTVFGICALLKPVTFGKRVGSSZSGKQTTAGSGGFFVCK
QQITRRKKGSQEDPLIFSTGSDAQWNENSRZGILVMRLSKRIFTZILLNZKZSFKSIZSIYEZTWSDSYQCLISEAPISA
ICLFRSSIVAZLPVVZITTIREGLPSGPSAAMIPRDPRSPAPDLSAINQPAGRAERRSGPATLSASIQSINCCREARVSS
SPVNSLRNVVAIATGIVVSRSSFGMASFSSGSQRSRRVTZSPMLCKKAVSSFGPPIVVRSKLAAVLSLMVMAALHNSLTV
MPSVRCFSVTGEYSTKSFZEZCMRRPSCSCPASIRDNTAPHSRTLKVLIIGKRSSGRKLSRILPLLRSSSMZPTRAPNZS
SASFTFTSVSGZAKTGRQNAAKKGIRATRKCZILILFLFQYYZSIYQGYCLMSGYIFECIZKNKQIGVPRTFPRKVPPGS
FSSRAIKIIIIZIFZYKYINZKZKVKKEIKEKIVFVFRRCKRLZGDRQQILPFILLFLLSGINAELFHLVCVEDHTRKSC
DFTFYLSLIECISIZSAFLVZZIYMZSTLFVEIFZTFVYFFFFIPZLFYLLYLLSKIQIQNIKINKHRVNSQIIPSLKDT
RRVZVTGKRSVLRNHYYHDINLZKZAYHEALS

Eugenia Xu
Department of Cell & Structural Biology
University of Illinois at Urbana-Champaign
Urbana. IL 61801

eugy at uxa.cso.uiuc.edu



More information about the Yeast mailing list