new PDR gene on chr IV

Mike Cherry cherry at GENOME.STANFORD.EDU
Thu Aug 3 11:21:35 EST 1995


Hello,

For all those interested in the multidrug resistance genes there
appears to be a new member of this family included in the sequence
SCD9509 (acc num U32274). This sequence is from chromosome IV right
and was determined by the Stanford DNA Sequence & Technology Center --
released this morning by NCBI/GenBank.  This ORF has striking
similarity with both PDR5 and PDR10 and appears to be a new member of
the PDR family that has yet to be named.

Mike Cherry

     Contacts for the Saccharomyces Genome Database Project (SGD)
             e-mail:    yeast-curator at genome.stanford.edu
                ftp:    genome-ftp.stanford.edu
             Gopher:    genome-gopher.stanford.edu
                WWW:    http://genome-www.stanford.edu/
          Telephone:    415-725-8956
                FAX:    415-723-7016

---

Here is that ORFs information:

     CDS             41950. .46539
                     /gene="D9509.24"
                     /note="similar to Pdr5p, multidrug resistance transporter,
                     from SwissProt Accession Number P33302; contains motifs
                     typical of ABC transporter family proteins and
                     ATP/GTP-binding sites;  CAI: 0.18;  NCBI gi: 927337"
                     /codon_start=1
                     /evidence=not_experimental
                     /product="D9509.24p"
                     /translation="MSSDIRDVEERNSRSSSSSSSSNSAAQSIGQHPYRGFDSEAAER
                     VHELARTLTSQSLLYTANSNNSSSSNHNAHNADSRSVFSTDMEGVNPVFTNPDTPGYN
                     PKLDPNSDQFSSTAWVQNMANICTSDPDFYKPYSLGCVWKNLSASGDSADVSYQSTFA
                     NIVPKLLTKGLRLLKPSKEEDTFQILKPMDGCLNPGELLVVLGRPGSGCTTLLKSISS
                     NSHGFKIAKDSIVSYNGLSSSDIRKHYRGEVVYNAESDIHLPHLTVYQTLFTVARMKT
                     PQNRIKGVDREAYANHVTEVAMATYGLSHTRDTKVGNDLVRGVSGGERKRVSIAEVAI
                     CGARFQCWDNATRGLDSATALEFIRALKTQADIGKTAATVAIYQCSQDAYDLFDKVCV
                     LDDGYQLYFGPAKDAKKYFQDMGYYCPPRQTTADFLTSITSPTERIISKEFIEKGTRV
                     PQTPKDMAEYWLQSESYKNLIKDIDSTLEKNTDEARNIIRDAHHAKQAKRAPPSSPYV
                     VNYGMQVKYLLIRNFWRMKQSASVTLWQVIGNSVMAFILGSMFYKVMKKNDTSTFYFR
                     GAAMFFAILFNAFSCLLEIFSLYETRPITEKHRTYSLYHPSADAFASVLSEMPPKLIT
                     AVCFNIIFYFLVDFRRNGGVFFFYFLINVIATFTLSHLFRCVGSLTKTLQEAMVPASM
                     LLLAISMYTGFAIPKTKILGWSIWIWYINPLAYLFESLMINEFHDRRFPCAQYIPAGP
                     AYQNITGTQRVCSAVGAYPGNDYVLGDDFLKESYDYEHKHKWRGFGIGMAYVVFFFFV
                     YLILCEYNEGAKQKGEMVVFLRSKIKQLKKEGKLQEKHRPGDIENNAGSSPDSATTEK
                     KILDDSSEGSDSSSDNAGLGLSKSEAIFHWRDLCYDVPIKGGQRRILNNVDGWVKPGT
                     LTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGRLRDESFPRSIGYCQQQDLHLK
                     TATVRESLRFSAYLRQPSSVSIEEKNRYVEEVIKILEMQQYSDAVVGVAGEGLNVEQR
                     KRLTIGVELAARPKLLVFLDEPTSGLDSQTAWDTCQLMRKLATHGQAILCTIHQPSAI
                     LMQQFDRLLFLQKGGQTVYFGDLGEGCKTMIDYFESKGAHKCPPDANPAEWMLEVVGA
                     APGSHATQDYNEVWRNSDEYKAVQEELDWMEKNLPGRSKEPTAEEHKPFAASLYYQFK
                     MVTIRLFQQYWRSPDYLWSKFILTIFNQVFIGFTFFKADRSLQGLQNQMLSIFMYTVI
                     FNPILQQYLPSFVQQRDLYEARERPSRTFSWLAFFLSQIIVEIPWNILAGTIAYCIYY
                     YAVGFYANASAAGQLHERGALFWLFSIAFYVYIGSMGLLMISFNEVAETAAHMGTLLF
                     TMALSFCGVMATPKVMPRFWIFMYRVSPLTYMIDALLALGVANVDVKCSNYEMVKFTP
                     PSGTTCGDYMASYIKLAGTGYLSDPSATDICSFCAVSTTNAFLATFSSHYYRRWRNYG
                     IFICYIAFDYIAATFLYWLSRVPKKNGKISEKPKK"




More information about the Yeast mailing list