Looking for Cyclin H.....

francis at NCBI.NLM.NIH.GOV francis at NCBI.NLM.NIH.GOV
Tue Oct 10 16:08:56 EST 1995


I said:

> > NCBI's WWW Entrez:   http://www.ncbi.nlm.nih.gov/
> > NCBI's Network Entrez application (clients exist for Mac, 
> >                                   PC windows, Unix and others) 

Mike Moser (moser at u.washington.edu) said:

> Hey guys,
> 
> I think it would help more if you read what the guy actually wrote, not 
> what you think he wrote:
> 
> Charles Yang <cyang at jhunix.hcf.jhu.edu> writes:
> 
> > My problem:  I can't find the nucleotide and amino acid sequences for 
> > the Cyclin H gene (the human counterpart to CCL1) and its corresponding 
> > protein.
> 
> I think he's trying to find the sequence of some CCL1 homolog, not CCL1.  
> Maybe he's not THAT clueless, although why post a request for a human 
> gene to yeast newsgroup...


There are very few people THAT clueless on the net, except those who
missread a question ...  ;-)

Trying again ... going about it the yeast route ...


find yeast cyclin protein (CCL1), get protein, get neighbor list (14
records), see one human in there, link to nucleotide record, and find
the sought after record, attached below!

;-)

f.

--
| B.F. Francis Ouellette  
| GenBank
|
| francis at ncbi.nlm.nih.gov   



LOCUS       HSU11791     1203 bp    mRNA            PRI       08-SEP-1994
DEFINITION  Human cyclin H mRNA, complete cds.
ACCESSION   U11791
KEYWORDS    .
SOURCE      human.
  ORGANISM  Homo sapiens
            Eukaryotae; Hyperchondria; Eukaryote crown group; Metazoa/Eumycota
            group; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia;
            Chordata; Vertebrata; Gnathostomata; Osteichthyes; Sarcopterygii;
            Choanata; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Archonta;
            Primates; Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1203)
  AUTHORS   Makela,T.P., Tassan,J-.P., Nigg,E., Frutiger,S., Hughes,G. and
            Weinberg,R.A.
  TITLE     A cyclin associated with the CDK-activating kinase MO15
  JOURNAL   Nature 371, 254-257 (1994)
  MEDLINE   94359612
REFERENCE   2  (bases 1 to 1203)
  AUTHORS   Makela,T.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUL-1994)
COMMENT     NCBI gi: 536919
FEATURES             Location/Qualifiers
     source          1..1203
                     /clone="F11-1"
                     /clone_lib=" Clontech HL1151x 5' stretch cDNA library"
                     /organism="Homo sapiens"
                     /dev_stage="fetus"
                     /tissue_type="liver"
     CDS             61..1032
                     /codon_start=1
                     /product="cyclin H"
                     /translation="MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPND
                     PVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPR
                     IIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIV
                     HNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAIL
                     SSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQK
                     LERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL"
BASE COUNT      376 a    241 c    248 g    338 t
ORIGIN
        1 ggacgctgat gcgtttgggt tctcgtctgc agaccctctg gacctggtca cgattccata
       61 atgtaccaca acagtagtca gaagcggcac tggaccttct ccagcgagga gcagctggca
      121 agactgcggg ctgacgccaa ccgcaaattc agatgcaaag ccgtggccaa cgggaaggtt
      181 cttccgaatg atccagtctt tcttgagcct catgaagaaa tgacactctg caaatactat
      241 gagaaaaggt tattggaatt ctgttcggtg tttaagccag caatgccaag atctgttgtg
      301 ggtacggctt gtatgtattt caaacgtttt tatcttaata actcagtaat ggaatatcac
      361 cccaggataa taatgctcac ttgtgcattt ttggcctgca aagtagatga attcaatgta
      421 tctagtcctc agtttgttgg aaacctccgg gagagtcctc ttggacagga gaaggcactt
      481 gaacagatac tggaatatga actacttctt atacagcaac ttaatttcca ccttattgtc
      541 cacaatcctt acagaccatt tgagggcttc ctcatcgact taaagacccg ctatcccata
      601 ttggagaatc cagagatttt gaggaaaaca gctgatgact ttcttaatag aattgcattg
      661 acggatgctt accttttata cacaccttcc caaattgccc tgactgccat tttatctagt
      721 gcctccaggg ctggaattac tatggaaagt tatttatcag agagtctgat gctgaaagag
      781 aacagaactt gcctgtcaca gttactagat ataatgaaaa gcatgagaaa cttagtaaag
      841 aagtatgaac cacccagatc tgaagaagtt gctgttctga aacagaagtt ggagcgatgt
      901 cattctgctg agcttgcact taacgtaatc acgaagaaga ggaaaggcta tgaagatgat
      961 gattacgtct caaagaaatc caaacatgag gaggaagaat ggactgatga cgacctggta
     1021 gaatctctct aaccatttga agttgatttc tcaatgctaa ctaatcaaga gaagtaggaa
     1081 gcatatcaaa cgtttaactt tatttaaaaa gtataatgtg aaaacataaa atatattaaa
     1141 acttttctat tgttttcttt ccctttcaca gtaactttat gtaaaataaa ccatcttcaa
     1201 aag
//



More information about the Yeast mailing list