muT homolog

francis at NCBI.NLM.NIH.GOV francis at NCBI.NLM.NIH.GOV
Sat Apr 5 16:27:37 EST 1997


> From bregeon at ijm.jussieu.fr Sat Apr  5 10:39:16 1997

> I'm working on the protein mutT (7,8-DIHYDRO-8-OXOGUANINE-TRIPHOSPHATASE)
> from Escherichia coli and i would like to know if there is an homolog
> protein in Saccharomyces cerevisiae or in Schizsaccharomyces pombe.

Firt I looked in Entrez:

http://www3.ncbi.nlm.nih.gov/Entrez/

to see if the protein sequence had 'neighbors' (pre-computed [blastp]
similar sequences) from Sc or Sp, and it appears that it does not.

I then did a blastp with with the E. coli mutT AA sequence against the
complete yeast genome AA sequences, a 'blastable' database we maintain
and update at NCBI, on our blast server: 

http://www.ncbi.nlm.nih.gov/BLAST/

and didn't pick up too much. The alignment of the best Sc score
(YBR111c; protein ecoded by EMBL/GenBank Accession Number Z35980) and
the mutT is shown below.  Nothing worth writing home about, although
some domains may be conserved.  The dot plot between these two
sequences shows that something may be there as well.  An alignment
with other related sequences may show something, but I'll let you 
do that ;-).

I didn't check for pombe ...

cheers,

f.

--
| B.F. Francis Ouellette  
| GenBank Coordinator
|
| francis at ncbi.nlm.nih.gov   


> -- 
> BREGEON Damien
> Institut Jacques MONOD
> 2, Place Jussieu 75251 Paris cedex05
> e-mail : bregeon at ijm.jussieu.fr
> 
> 


56 borduas > align ybr111c.fsa mutt.fsa
 ybr111c.fsa :  231 aa
>gi|536466 ORF YBR111c                              231 aa vs.
>gi|1786288 7,8-dihydro-8-oxoguanine-triphosphata   129 aa
14.7% identity; Optimized score: -326

               10        20        30        40        50        60
ybr111 MFLRNVRVISLNSRRLFRTMSTVKGKPEDAKIIEARHVKETSDCKWIGLQKIIYKDPNGK
       :            ..:  .......  :...:. .:..                      
gi|178 M------------KKLQIAVGIIRN--ENNEIFITRRA----------------------
                           10          20                          

               70        80        90       100       110       120
ybr111 EREWDSAVRTTRSSGGVDGIGILTILKYKDGKPDEILLQKQFRPPVEGVCIEMPAGLIDA
                                       .:. . .:          .:.:.: :. 
gi|178 --------------------------------ADAHMANK----------LEFPGGKIEM
                                           30                  40  

              130       140       150       160       170       180
ybr111 GEDIDTAALRELKEETGYSGKIISKSPTVFNDPGFTNTNLCLVTVEVDMSLPENQKPVTQ
       ::. . :..:::.::.:    :...  ..:.. ...     . . .... .      :..
gi|178 GETPEQAVVRELQEEVG----ITPQHFSLFEKLEYE-----FPDRHITLWF----WLVER
             50            60        70             80             
 
              190       200       210       220       230 
ybr111 LEDNEFIECFSVELHKFPDEMVKLDQQGYKLDARVQNVAQGILMAKQYHIK
        :.    : .. : .  :.: ..:      :.:     :.. ..::  .. 
gi|178 WEG----EPWGKEGQ--PGEWMSLVG----LNADDFPPANEPVIAKLKRL-
      90           100             110       120          

Elapsed time:  0:00:00



More information about the Yeast mailing list