IUBio

[Genbank-bb] GenBank Release 211.0 Available : December 18 2015

Cavanaugh, Mark (NIH/NLM/NCBI) [E] via genbankb%40net.bio.net (by cavanaug from ncbi.nlm.nih.gov)
Fri Dec 18 14:07:30 EST 2015


Greetings GenBank Users,

  GenBank Release 211.0 is now available via FTP from the National Center
for Biotechnology Information (NCBI):

  Ftp Site           Directory   Contents
  ----------------   ---------   ---------------------------------------
  ftp.ncbi.nih.gov   genbank     GenBank Release 211.0 flatfiles
                     ncbi-asn1   ASN.1 data used to create Release 211.0

  Close-of-data for GenBank 211.0 occurred on 12/14/2015. Uncompressed,
the Release 211.0 flatfiles require roughly 749 GB (sequence files only).
The ASN.1 data require approximately 613 GB.

Recent statistics for 'traditional' sequences (including non-bulk-oriented
TSA, and excluding WGS, bulk-oriented TSA, and the CON-division):

  Release  Date      Base Pairs    Entries

  210      Oct 2015  202237081559  188372017
  211      Dec 2015  203939111071  189232925

Recent statistics for WGS sequencing projects:

  Release  Date      Base Pairs    Entries

  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157

Recent statistics for bulk-oriented TSA sequencing projects:

  Release  Date      Base Pairs     Entries

  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539

  During the 60 days between the close dates for GenBank Releases 210.0
and 211.0, the 'traditional' portion of GenBank grew by 1,702,029,512
basepairs and by 860,908 sequence records. During that same period,
1,626,191 records were updated. An average of 41,451 'traditional' records
were added and/or updated per day.

  Between releases 210.0 and 211.0, the WGS component of GenBank grew by
75,230,350,867 basepairs and by 7,923,214 sequence records.

  Between releases 210.0 and 211.0, the TSA component of GenBank grew by
6,666,166,232 basepairs and by 5,698,508 sequence records.

  For additional release information, see the README files in either of
the directories mentioned above, and the release notes (gbrel.txt) in
the genbank directory. Sections 1.3 and 1.4 of the release notes
(Changes in Release 211.0 and Upcoming Changes) have been appended
below for your convenience.

                    * * * Important * * *

  A significant change is described in Section 1.4.1 of the release
notes: Removal of NCBI GI sequence identifiers from GenBank, GenPept,
and FASTA sequence formats. Users who make use of GIs in their information
systems and analysis pipelines should take particular note of that section.

  Release 211.0 data, and subsequent updates, are available now via
NCBI's Entrez and Blast services.

  As a general guideline, we suggest first transferring the GenBank
release notes (gbrel.txt) whenever a release is being obtained. Check
to make sure that the date and release number in the header of the
release notes are current (eg: December 15 2015, 211.0). If they are
not, interrupt the remaining transfers and then request assistance from
the NCBI Service Desk.

  A comprehensive check of the headers of all release files after your
transfers are complete is also suggested. Here's how one might go about
this on a Unix or Linux platform, using csh/tcsh :

        set files = `ls gb*.*`
        foreach i ($files)
                head -10 $i | grep Release
        end

Or, if the files are compressed, perhaps:

        gzcat $i | head -10 | grep Release

  If you encounter problems while ftp'ing or uncompressing Release
211.0, please send email outlining your difficulties to:

        info from ncbi.nlm.nih.gov

Mark Cavanaugh, Michael Kimelman, Ilya Dondoshansky, Sergey Zhdanov,
GenBank
NCBI/NLM/NIH/HHS


1.3 Important Changes in Release 211.0

1.3.1 Organizational changes

The total number of sequence data files increased by 29 with this release:

  - the BCT division is now composed of 216 files (+8)
  - the CON division is now composed of 327 files (+3)
  - the ENV division is now composed of  88 files (+2)
  - the INV division is now composed of 135 files (+3)
  - the PAT division is now composed of 242 files (+7)
  - the PLN division is now composed of 122 files (+3)
  - the PRI division is now composed of  50 files (+1)
  - the ROD division is now composed of  32 files (+1)
  - the TSA division is now composed of 194 files (-1)
  - the VRL division is now composed of  39 files (+1)
  - the VRT division is now composed of  60 files (+1)

Note: The 'loss' of gbtsa195.seq is due to improved packaging of
sequence records, which resulted in one less file for that division.

1.3.2 Expansion of /rpt_unit controlled vocabulary and conversion of LTR features

  The /rpt_unit qualifier, often used for repeat_region features, currently
has a very limited number of allowed values:

    Qualifier       /rpt_type=
    Definition      organization of repeated sequence
    Value format    tandem, inverted, flanking, terminal, direct, dispersed, and other

  As of this GenBank Release 211.0, this controlled vocabulary has been
expanded to include seven new terms:

     long_terminal_repeat
     non_LTR_retrotransposon_polymeric_tract
     X_element_combinatorial_repeat
     Y_prime_element
     telomeric_repeat
     centromeric_repeat
     engineered_foreign_repetitive_element

  With "long_terminal_repeat" now a supported value, this allows for the
conversion of existing LTR features into repeat_region features. The
definition for LTR is:

    Feature Key  LTR
    Definition   long terminal repeat, a sequence directly repeated at
                 both ends of a defined sequence, of the sort typically
                 found in retroviruses;

  LTRs are just another variety of repetitive region, so representing
them via repeat_region features with an appropriate /rpt_type qualifier
will simplify the Feature Table. This change will also occur as of the
December 2015 GenBank Release.

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 127
of the GSS flatfiles in Release 211.0. Consider gbgss173.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        December 15 2015

                NCBI-GenBank Flat File Release 211.0

                           GSS Sequences (Part 1)

   87032 loci,    63853715 bases, from    87032 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "173" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 GI sequence identifiers to be removed from GenBank/GenPept/FASTA formats

  As of 06/15/2016, the integer sequence identifiers known as "GIs" will no
longer be included in the GenBank, GenPept, and FASTA formats supported by
NCBI for the display of sequence records.

  As first described in the Release Notes for GenBank 199.0 in December 2013,
NCBI is in the process of moving to storage solutions which utilize only
Accession.Version identifiers. See Section 1.4.3 of these release notes for
additional background information about those developments.

  Although GI sequence identifiers served their purpose well for many years,
the Accession.Version system is completely equivalent (and much more
human-readable).

  And given the shift to non-GI-based systems, the importance of using
Accession.Version identifiers cannot be overstated. So as an initial step, NCBI
will cease the display of GI identifiers in the flatfile and FASTA views of
all sequence records.

  Previously-assigned GI identifiers will continue to exist 'behind the scenes',
and NCBI services (including URLs, APIs, etc) which accept GIs as inputs/arguments
will be supported, for those sequence records that have GIs, for the foreseeable
future.

  Over the next year NCBI will identify all such services that do not yet
support Accession.Version identifiers, and add that support. Users of those
services will then be encouraged to make use of Accession.Version rather than GIs.
Of course, for those services that already support Accession.Version, NCBI
encourages users to begin transitioning away from GI as soon as is practical.

  In the sample record below, nucleotide sequence AF123456 has been assigned a
GI of 6633795, and the protein translation of its coding region feature has
been assigned a GI of 6633796 :

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2  GI:6633795
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /db_xref="GI:6633796"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

  After June 15 2016, the GI value on the VERSION line and the GI /db_xref
qualifier for the coding region feature will no longer be displayed:

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

  Similarly,  the GI value will be removed from the VERSION line of the GenPept
format. Currently:

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1  GI:6633796
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

As of 06/15/2016:

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

  Note that the coding region feature for GenPept format has never included
the display of nucleotide GI values.

For FASTA format, GI values will be removed from the FASTA header/defline:

Currently:

>gi|6633795|gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>gi|6633796|gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE

As of 06/15/2016:

>gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE

Please direct any inquiries about these changes to the NCBI Service Desk:

  info from ncbi.nlm.nih.gov

1.4.2 GI sequence identifiers are being phased out at NCBI

  The numeric GI sequence identifier that NCBI used to assign to all
nucleotide and protein sequences was first introduced for GenBank Release
products as of GenBank 81.0, in February 1994. See:

     ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes

 These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for over 20 years. 

  However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.

  Such a change will likely have a significant impact on NCBI users who
utilize GIs in their own information systems and analysis pipelines, so it is
being implemented gradually. Unannotated WGS projects consisting of millions
of contigs and scaffolds, and unannotated TSA projects, are the first two
classes of records for which GIs are no longer being assigned. But the practice
will ultimately expand to include other classes of records.

  If GIs are central to your operations, NCBI strongly urges that you begin
planning a switch to the use of Accession.Version identifiers instead.

  The contigs and scaffolds of the ALWZ04 WGS project are good examples of
sequences that lack GIs. Below are excerpts from the flatfile representation
of the first ALWZ04 contig, and the 'singleton scaffold' which is constructed
from it. Note the absence of a GI value on the VERSION line of these two
records:

LOCUS       ALWZ040000001           1191 bp    DNA     linear   PLN 13-MAR-2015
DEFINITION  Picea glauca, whole genome shotgun sequence.
ACCESSION   ALWZ040000001 ALWZ040000000
VERSION     ALWZ040000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
ORIGIN      
        1 ctataatacc cctatgccaa acgaacccaa ttgtaaatgt aaatgcaaat gtacttaggc
       61 tggttagttg tttaatatca ttttttgtat gcaccttcca tggtataatg cgcacatgta
      121 tagcgcacta aaattatgaa gtgtgcccat tccaagatat tgcgcgtaaa aaacttaagt
      181 gtgcatgatt ttgagactag ggagactttg tgtatatgtt gtgttttata tgctggagag
      241 acaattatta ttagttagga ggattatgtt ttgtactagg caagagagcc tagatgttaa
      301 aggctagtga gcctattttt gtatatgtct catcattaat ataatacatc attgtgtgta
....
      901 ttgttgggaa ttgatttcct gaatgtgtta aactgcattg atagggatct gagaattcct
      961 ttctggccta ttgctgaagc tttggaaggg aggtggggca accgagggac tgttgagaag
     1021 agaagggtca cacttcctgg ggtgggacaa gcatgtgggg aattagggat tgcaggatgt
     1081 tagtttgaat tggcacctat gacagagtct ttcctattgt ctgagatatg tcagcttggt
     1141 taggaaaccc tttacctggg tagagtttag tcccagctcg ggggtgaccc a
//

LOCUS       ALWZ04S0000001          1191 bp    DNA     linear   CON 13-MAR-2015
DEFINITION  Picea glauca Pg-01r141201s0000001, whole genome shotgun sequence.
ACCESSION   ALWZ04S0000001 ALWZ0400000000
VERSION     ALWZ04S0000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
CONTIG      join(ALWZ040000001.1:1..1191)
//

Sample URLs from which ALWZ04 data may be obtained include:

  http://www.ncbi.nlm.nih.gov/Traces/wgs/?val=ALWZ04#contigs
  http://www.ncbi.nlm.nih.gov/Traces/wgs/?val=ALWZ04#scaffolds

  http://www.ncbi.nlm.nih.gov/Traces/wgs/?download=ALWZ04.gbff.1.gz
  http://www.ncbi.nlm.nih.gov/Traces/wgs/?download=ALWZ04S.gbff.1.gz

  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.*.gbff.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.*.gbff.gz





More information about the Genbankb mailing list

Send comments to us at biosci-help [At] net.bio.net