Greetings GenBank Users,
GenBank Release 213.0 is now available via FTP from the National Center
for Biotechnology Information (NCBI):
Ftp Site Directory Contents
---------------- --------- ---------------------------------------
ftp.ncbi.nih.gov genbank GenBank Release 213.0 flatfiles
ncbi-asn1 ASN.1 data used to create Release 213.0
Close-of-data for GenBank 213.0 occurred on 04/14/2016. Uncompressed,
the Release 213.0 flatfiles require roughly 771 GB (sequence files only).
The ASN.1 data require approximately 633 GB.
Recent statistics for 'traditional' sequences (including non-bulk-oriented
TSA, and excluding WGS, bulk-oriented TSA, and the CON-division):
Release Date Base Pairs Entries
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
Recent statistics for WGS sequencing projects:
Release Date Base Pairs Entries
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
Recent statistics for bulk-oriented TSA sequencing projects:
Release Date Base Pairs Entries
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
During the 61 days between the close dates for GenBank Releases 212.0
and 213.0, the 'traditional' portion of GenBank grew by 4,405,715,980
basepairs and by 3,489,276 sequence records. During that same period,
539,559 records were updated. An average of 66,046 'traditional' records
were added and/or updated per day.
Between releases 212.0 and 213.0, the WGS component of GenBank grew by
52,342,209,341 basepairs and by 5,909,777 sequence records.
Between releases 212.0 and 213.0, the TSA component of GenBank grew by
5,878,608,582 basepairs and by 6,015,248 sequence records.
For additional release information, see the README files in either of
the directories mentioned above, and the release notes (gbrel.txt) in
the genbank directory. Sections 1.3 and 1.4 of the release notes
(Changes in Release 213.0 and Upcoming Changes) have been appended
below for your convenience.
* * * IMPORTANT * * *
A significant change is described in Section 1.4.1 of the release
notes: Removal of NCBI GI sequence identifiers from GenBank, GenPept,
and FASTA sequence formats. Users who make use of GIs in their information
systems and analysis pipelines should take particular note of that section.
* * * IMPORTANT * * *
Release 213.0 data, and subsequent updates, are available now via
NCBI's Entrez and Blast services.
As a general guideline, we suggest first transferring the GenBank
release notes (gbrel.txt) whenever a release is being obtained. Check
to make sure that the date and release number in the header of the
release notes are current (eg: April 15 2016, 213.0). If they are
not, interrupt the remaining transfers and then request assistance from
the NCBI Service Desk.
A comprehensive check of the headers of all release files after your
transfers are complete is also suggested. Here's how one might go about
this on a Unix or Linux platform, using csh/tcsh :
set files = `ls gb*.*`
foreach i ($files)
head -10 $i | grep Release
end
Or, if the files are compressed, perhaps:
gzcat $i | head -10 | grep Release
If you encounter problems while ftp'ing or uncompressing Release
213.0, please send email outlining your difficulties to:
info from ncbi.nlm.nih.gov
Mark Cavanaugh, Michael Kimelman, Ilya Dondoshansky, Sergey Zhdanov,
GenBank
NCBI/NLM/NIH/HHS
1.3 Important Changes in Release 213.0
1.3.1 Organizational changes
The total number of sequence data files increased by 58 with this release:
- the BCT division is now composed of 238 files (+14)
- the CON division is now composed of 334 files (+4)
- the ENV division is now composed of 91 files (+2)
- the GSS division is now composed of 300 files (+1)
- the PAT division is now composed of 251 files (+5)
- the TSA division is now composed of 228 files (+34)
- the PRI division is now composed of 53 files (-1)
- the VRT division is now composed of 60 files (-1)
Note: The 'loss' of gbpri54.seq and gbvrt61.seq is due to improved
packaging of sequence records, which resulted in one less file for
those two divisions.
1.3.2 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for 128
of the GSS flatfiles in Release 213.0. Consider gbgss173.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
April 15 2016
NCBI-GenBank Flat File Release 213.0
GSS Sequences (Part 1)
87032 loci, 63853715 bases, from 87032 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "173" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 GI sequence identifiers to be removed from GenBank/GenPept/FASTA formats
and FASTA header to be simplified
As of September 15 2016, the integer sequence identifiers known as "GIs" will
no longer be included in the GenBank, GenPept, and FASTA formats for GenBank
Release and GenBank Update products. The FASTA header will be further simplified,
to report only the sequence Accession.Version for records that originate within
the International Sequence Database Collaboration (INSDC).
September 15th is now the earliest date by which these changes will take
place (rather than June 15th, previously announced). But if the format changes
prove to be a hardship for GenBank users, the implementation date might be
postponed further.
As first described in the Release Notes for GenBank 199.0 in December 2013,
NCBI is in the process of moving to storage solutions which utilize only
Accession.Version identifiers. See Section 1.4.2 of these release notes for
additional background information about those developments.
Given this shift to non-GI-based systems, the importance of using
Accession.Version identifiers cannot be overstated. NCBI plans to cease the
display of GI identifiers in the flatfile and FASTA views of all nucleotide
and protein sequence records in September 2016, so any processes solely
dependent on GIs will need to be adjusted before that time or they will
cease to work.
Previously-assigned GI sequence identifiers will continue to exist
'behind the scenes', and NCBI services which accept GIs as inputs will
continue to be supported. NCBI will be adding support for Accession.Version
identifiers to any services that currently do not support them. As NCBI
makes this transition, we encourage any users who have workflows that
depend on GIs to begin planning to use Accession.Version identifiers instead.
The FASTA format will also be changed for all sequence records originating
within the INSDC, to report only the Accession.Version and the record title.
This will improve compatibility with other file types provided by NCBI and
others, including GFF3, Gene, and dbSNP download files. This FASTA format
change has already been made for the redesigned genomes FTP site based on
user requests to have a single consistent sequence identifier for both GFF3
and FASTA formats.
At this time, we plan to continue to provide database source information in
the FASTA header/definition line for non-INSDC source of sequence data,
including UniProt, PDB structures, PIR, and Patent sequences.
Example 1 : An INSDC nucleotide record
In the sample record below, nucleotide sequence AF123456 was assigned a
GI of 6633795, and the protein translated from its coding region feature
was assigned a GI of 6633796 :
LOCUS AF123456 1510 bp mRNA linear VRT 12-APR-2012
DEFINITION Gallus gallus doublesex and mab-3 related transcription factor 1
(DMRT1) mRNA, partial cds.
ACCESSION AF123456
VERSION AF123456.2 GI:6633795
....
CDS <1..936
/gene="DMRT1"
/note="cDMRT1"
/codon_start=1
/product="doublesex and mab-3 related transcription factor
1"
/protein_id="AAF19666.1"
/db_xref="GI:6633796"
/translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"
After September 15 2016, the Accession.Version will be the sole sequence
version identifier. The GI value on the VERSION line and the GI /db_xref
qualifier for the coding region feature will no longer be visible:
LOCUS AF123456 1510 bp mRNA linear VRT 12-APR-2012
DEFINITION Gallus gallus doublesex and mab-3 related transcription factor 1
(DMRT1) mRNA, partial cds.
ACCESSION AF123456
VERSION AF123456.2
....
CDS <1..936
/gene="DMRT1"
/note="cDMRT1"
/codon_start=1
/product="doublesex and mab-3 related transcription factor
1"
/protein_id="AAF19666.1"
/translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"
Example 2 : A GenPept record for an INSDC sequence
The current GenPept display format includes GI identifiers in the VERSION lines
(note that the coding region feature for GenPept has never included the display
of GI identifiers) :
LOCUS AAF19666 311 aa linear VRT 12-APR-2012
DEFINITION doublesex and mab-3 related transcription factor 1, partial [Gallus
gallus].
ACCESSION AAF19666
VERSION AAF19666.1 GI:6633796
DBSOURCE accession AF123456.2
....
CDS 1..311
/gene="DMRT1"
/coded_by="AF123456.2:<1..936"
After September 15 2016, the VERSION line will no longer include the GI value:
LOCUS AAF19666 311 aa linear VRT 12-APR-2012
DEFINITION doublesex and mab-3 related transcription factor 1, partial [Gallus
gallus].
ACCESSION AAF19666
VERSION AAF19666.1
DBSOURCE accession AF123456.2
....
CDS 1..311
/gene="DMRT1"
/coded_by="AF123456.2:<1..936"
Example 3: FASTA format for an INSDC nucleotide and protein sequence
The current FASTA display, for most products, includes GI and database
source information (eg, 'gb' for GenBank, 'emb' for ENA, 'dbj' for
DDBJ), using the '|' character as a delimiter:
>gi|6633795|gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]
>gi|6633796|gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE
As of September 15 2016, just the Accession.Version will be provided:
>AF123456.2 Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]
>AAF19666.1 doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE
Please direct any inquiries about these changes to the NCBI Service Desk:
info from ncbi.nlm.nih.gov
1.4.2 GI sequence identifiers are being phased out at NCBI
The numeric GI sequence identifier that NCBI used to assign to all
nucleotide and protein sequences was first introduced for GenBank Release
products as of GenBank 81.0, in February 1994. See:
ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes
These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for over 20 years.
However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.
Such a change will likely have a significant impact on NCBI users who
utilize GIs in their own information systems and analysis pipelines, so it is
being implemented gradually. Unannotated WGS projects consisting of millions
of contigs and scaffolds, and unannotated TSA projects, are the first two
classes of records for which GIs are no longer being assigned. But the practice
will ultimately expand to include other classes of records.
If GIs are central to your operations, NCBI strongly urges that you begin
planning a switch to the use of Accession.Version identifiers instead.
The contigs and scaffolds of the ALWZ04 WGS project are good examples of
sequences that lack GIs. Below are excerpts from the flatfile representation
of the first ALWZ04 contig, and the 'singleton scaffold' which is constructed
from it. Note the absence of a GI value on the VERSION line of these two
records:
LOCUS ALWZ040000001 1191 bp DNA linear PLN 13-MAR-2015
DEFINITION Picea glauca, whole genome shotgun sequence.
ACCESSION ALWZ040000001 ALWZ040000000
VERSION ALWZ040000001.1
DBLINK BioProject: PRJNA83435
BioSample: SAMN01120252
....
ORIGIN
1 ctataatacc cctatgccaa acgaacccaa ttgtaaatgt aaatgcaaat gtacttaggc
61 tggttagttg tttaatatca ttttttgtat gcaccttcca tggtataatg cgcacatgta
121 tagcgcacta aaattatgaa gtgtgcccat tccaagatat tgcgcgtaaa aaacttaagt
181 gtgcatgatt ttgagactag ggagactttg tgtatatgtt gtgttttata tgctggagag
241 acaattatta ttagttagga ggattatgtt ttgtactagg caagagagcc tagatgttaa
301 aggctagtga gcctattttt gtatatgtct catcattaat ataatacatc attgtgtgta
....
901 ttgttgggaa ttgatttcct gaatgtgtta aactgcattg atagggatct gagaattcct
961 ttctggccta ttgctgaagc tttggaaggg aggtggggca accgagggac tgttgagaag
1021 agaagggtca cacttcctgg ggtgggacaa gcatgtgggg aattagggat tgcaggatgt
1081 tagtttgaat tggcacctat gacagagtct ttcctattgt ctgagatatg tcagcttggt
1141 taggaaaccc tttacctggg tagagtttag tcccagctcg ggggtgaccc a
//
LOCUS ALWZ04S0000001 1191 bp DNA linear CON 13-MAR-2015
DEFINITION Picea glauca Pg-01r141201s0000001, whole genome shotgun sequence.
ACCESSION ALWZ04S0000001 ALWZ0400000000
VERSION ALWZ04S0000001.1
DBLINK BioProject: PRJNA83435
BioSample: SAMN01120252
....
CONTIG join(ALWZ040000001.1:1..1191)
//
Sample URLs from which ALWZ04 data may be obtained include:
http://www.ncbi.nlm.nih.gov/Traces/wgs/?val=ALWZ04#contigshttp://www.ncbi.nlm.nih.gov/Traces/wgs/?val=ALWZ04#scaffoldshttp://www.ncbi.nlm.nih.gov/Traces/wgs/?download=ALWZ04.gbff.1.gzhttp://www.ncbi.nlm.nih.gov/Traces/wgs/?download=ALWZ04S.gbff.1.gzftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.*.gbff.gzftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.*.gbff.gz