In article <16BD8963E.60057923 at wsuvm1.csc.wsu.edu> 60057923 at wsuvm1.csc.wsu.edu(greg fraley) writes:
>>I am desperately seeking a source for a plasmid probe to use for in situ
>hybridizations and northern blotts for neuropeptide Y. Anyonw know of
>a source or where I can go to find one??? Any help will be greatly
>appreciated. Please rpley by email or by posting, I do log on regularly.
>> thanks--
>gsf
A little gophering finds that the Human neuropeptide Y Genbank entry
is as follows. Use gopher to retrieve the individual exons or the entries
for the neuropeptide Y from other species (sheep, pig, rat, rabbit, chicken,
cod, goldfish ...).
I would suggest that you contact the authors of the citations below as
they may well have the clones you're looking for.
Best of luck,
Dan Jacobson
danj at welchgate.welch.jhu.edu
--------------------------------------------------------------------------
LOCUS HUMNPYA 417 bp ss-mRNA PRI 26-OCT-1992
DEFINITION Human neuropeptide Y mRNA, complete cds.
ACCESSION M15789
KEYWORDS neuropeptide Y.
SOURCE Homo sapiens phenchromocytoma cDNA to mRNA.
ORGANISM Homo sapiens
Eukaryota; Animalia; Chordata; Vertebrata; Mammalia; Theria;
Eutheria; Primates; Haplorhini; Catarrhini; Hominidae.
REFERENCE 1 (bases 1 to 417)
AUTHORS Takeuchi,T., Gumucio,D.L., Yamada,T., Meisler,M.H., Minth,C.D.,
Dixon,J.E., Eddy,R.E. and Shows,T.B.Jr.
TITLE Genes encoding pancreatic polypeptide and neuropeptide Y are on
human chromosomes 17 and 7
JOURNAL J. Clin. Invest. 77, 1038-1041 (1986)
STANDARD full automatic
COMMENT Neuropeptide and pancreatic polypeptide Y share a 50% homology
suggesting common ancestral origins, see locus HUMPPY.
FEATURES Location/Qualifiers
CDS 15..308
/gene="NPY"
/product="neuropeptide Y"
/codon_start=1
/translation="MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAED
MARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW"
BASE COUNT 103 a 128 c 105 g 81 t
ORIGIN 1 bp upstream of BssHII site; chromosome 7.
1 gcgcgccagc caccatgcta ggtaacaagc gactggggct gtccggactc accctggccc
61 tgtccctgct cgtgtgcctg ggtgcgctgg ccgaggcgta cccctccaag ccggacaacc
121 cgggcgagga cgcaccagcg gaggacatgg ccagatacta ctcggcgctg cgacactaca
181 tcaacctcat caccaggcag agatatggaa aacgatccag cccagagaca ctgatttcag
241 acctcttgat gagagaaagc acagaaaatg ttcccagaac tcggcttgaa gaccctgcaa
301 tgtggtgatg ggaaatgaga cttgctctct ggcctttcct attttcagcc catatttcat
361 cgtgtaaaac gagaatccac ccatcctacc aatgcatgca gccactgtgc tgaattc
//
===========================================================================
Exon 1:
LOCUS HUMNPY02 247 bp ds-DNA PRI 15-JUN-1989
DEFINITION Human neuropeptide Y (NPY) gene, exon 1.
ACCESSION M14296
KEYWORDS neuropeptide Y.
SEGMENT 2 of 4
SOURCE Human placental DNA, clone pNPY-lambda-37-6.
ORGANISM Homo sapiens
Eukaryota; Animalia; Chordata; Vertebrata; Mammalia; Theria;
Eutheria; Primates; Haplorhini; Catarrhini; Hominidae.
REFERENCE 1 (bases 1 to 247)
AUTHORS Minth,C.D., Andrews,P.C. and Dixon,J.E.
TITLE Characterization, Sequence, and Expression of the Cloned Human
Neuropeptide Y Gene
JOURNAL J. Biol. Chem. 261, 11974-11979 (1986)
STANDARD full automatic
FEATURES Location/Qualifiers
exon <30..217
/number=1
/gene="NPY"
/note="neuropeptide Y"
intron <1..29
/note="neuropeptide Y, intron A"
intron 218..>247
/note="neuropeptide Y, intron B"
BASE COUNT 45 a 82 c 80 g 40 t
ORIGIN Chromosome 7pter-q22; 965 bp downstream of segment 1.
1 cccgtccgtt gagccttctg tgcctgcaga tgctaggtaa caagcgactg gggctgtccg
61 gactgaccct cgccctgtcc ctgctcgtgt gcctgggtgc gctggccgag gcgtacccct
121 ccaagccgga caacccgggc gaggacgcac cagcggagga catggccaga tactactcag
181 cgctgggaca ctacatcaac ctcatcacca ggcagaggtg ggtgggaccg cgggaccgat
241 tccggga
//
