Basic question

[Morten Lauritsen]

Hi all.

This was the group that sounded as the most appropriate to post these
questions to. Hope nobody minds.

I need to know the map between codons (triples of nucleotides) to
amino acids. The problem is that this is such a trivial bit of
knowledge that nobody seems to have cared to put it on a www site,
etc.

Also, does anybody know the map between the 20-letter coding of the
amino acids into the amino acid names? i.e. What is going on here:

MVHWTAEEKAAITSVWQKVNVEHDGHDALGRLLIVYPWTQRYFSNFGNLSNSAAVAGNAKVQAHGKKVLS
AVGNAISHIDSVKSSLQQLSKIHATELFVDPENFKRFGGVLVIVLGAKLGTAFTPKVQAAWEKFIAVLVD
GLSQGYN

I know it is the primary structure of a beta globin, but what is the
amino acid names?

Please reply by email so the newsgroup isn't bothered too much by
this.

thanks in advance,

					Morten Lauritsen.
--
 Morten Lauritsen   | Email: moffe at daimi.aau.dk  | To me, boxing is like ballet
 Spobjergvej 38 10  | ---------------------------| except there's no music,
 8220 Brabrand      | The world owes you nothing.| no choreography, and
 Phone: 89 44 91 50 |     It was here first.     | the dancers hit each other.